KEGG   Dokdonia sp. MED134: MED134_09986Help
Entry
MED134_09986      CDS       T03275                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
dok  Dokdonia sp. MED134
Pathway
dok00240  Pyrimidine metabolism
dok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dok00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MED134_09986 (tdk)
Enzymes [BR:dok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MED134_09986 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: EAQ39814
LinkDB All DBs
Position
2227930..2228586
Genome map
AA seq 218 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAVDVRYDEEM
VVSHDSNEIRSTPVPAAANIPILADDCDVVGIDEAQFFDDEIVKVCNDLANRGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSYRKAQGQDIVMLGETEEYEP
LSRAAYYKAMLRDRLRTMDVDQPEEITPSSKEAPQDPS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcaatttggctggatagaagtcatttgt
gggtcgatgttctctggtaaaacagaagaactcatccgtaggctcaagcgcgcgcagttt
gcaaaacaaaaagtagaaatctttaaacctgcggtagacgtgcgctatgatgaagaaatg
gtagtctctcacgactcaaatgagatacgatctacacctgtaccagcagcagcaaatatt
cctattcttgcagatgattgtgatgtggtaggtatagatgaagcacagttttttgatgat
gagattgtaaaggtttgtaatgatcttgcaaaccgaggcataagagtaatcgttgcggga
cttgatatggattttaaaggaaacccctttgggcctatgcctaaccttatggcaacagca
gagtatgtgactaaggtacacgcagtttgtactcgcacaggtaatctagcacaatacagt
tatagaaaagcacaggggcaagatattgtgatgctaggtgagacagaagagtatgagccg
ttatctagagctgcatattataaggcaatgctgcgtgaccgtctccgtacgatggatgta
gatcagccagaagagataacaccttcctcaaaagaggctcctcaagaccctagctag

DBGET integrated database retrieval system