KEGG   Desulfococcus oleovorans: Dole_2749Help
Entry
Dole_2749         CDS       T00610                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00473  D-Alanine metabolism
dol00550  Peptidoglycan biosynthesis
dol01100  Metabolic pathways
dol01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dole_2749
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dole_2749
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Dole_2749
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dol01011]
    Dole_2749
Enzymes [BR:dol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Dole_2749
Peptidoglycan biosynthesis and degradation proteins [BR:dol01011]
 Precursor biosynthesis
  Amino acid ligase
   Dole_2749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ABW68552
UniProt: A8ZXS5
LinkDB All DBs
Position
complement(3317281..3318297)
Genome map
AA seq 338 aa AA seqDB search
MKLAFLYNVRHQYPDPDRPETQVEADFDDPETIAAMTAHLRECGFDVIPIEADPDAYIKL
YENRDSIDLVFNYSIGIYGQARYAQVPAMLEMLRLPYTGSGPLTQALILDKARMQQVLSA
CNVPVLCSQVFETGDEPLQSGLAFPLIVKPVAQGSSAGITSDSVVRDEAALYRQVGRVMA
TFGEPALVQPFLDGREFSIPMMGNPPEIFPIIEPDFSRLPEGYARIDSLEVKWIFEEQAE
SHHLICPAPVAPGLQERLEQTVRAAWKALGICDWCRIDLRCDMAGTPYVIDVNSPPGMIP
PEGSMTSYFPMSARAAGIDYQGLLKRLIETAMDRLSAR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagccttcctttacaatgtccgtcaccagtaccccgatcctgaccgaccggaa
acccaggtcgaggccgattttgatgatccggaaaccattgcggccatgacggctcacctg
cgcgaatgcgggtttgacgtcattcccattgaagccgatccggatgcgtatatcaaactc
tatgaaaaccgtgacagtatcgacctggtttttaactactcaatcggtatttacggccag
gcccggtatgcccaggtgccggccatgctggagatgcttcggcttccctacaccggctcc
ggtcccctgacccaggccctgatcctggacaaggcccgcatgcagcaggtgctgtcggcc
tgcaacgtgccggtgctttgctcccaggtgtttgaaaccggcgacgaaccgctgcaaagc
gggctggcctttcccctgatcgtcaagcccgtggcccagggctcgtcggccggcatcaca
tccgacagcgtggtgcgggacgaggcggctctttaccgacaggtgggccgggtgatggcc
acctttggcgagccggccctggttcagccttttttagacggccgggagttttctattccc
atgatgggaaatcctcctgagatattcccgatcatcgaaccggatttttcccgcctgccc
gaaggctatgcccgcattgattctcttgaggtcaagtggatatttgaggagcaggccgag
tcccaccacctgatctgcccggcgcctgtggcaccgggcttacaagagcggctggagcag
accgtgcgggccgcgtggaaagccctgggcatttgcgactggtgccgtatcgacctgcgg
tgcgacatggcgggcactccctatgtcattgatgtcaactcgccgccgggcatgattccg
ccggaaggctccatgacctcctattttcccatgtcggcccgggccgcgggcatcgactac
cagggcctgctcaaaaggcttattgagactgccatggaccggctgagcgcaagataa

DBGET integrated database retrieval system