KEGG   Marivivens sp. JLT3646: BSK21_11410Help
Entry
BSK21_11410       CDS       T04589                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
don  Marivivens sp. JLT3646
Pathway
don00020  Citrate cycle (TCA cycle)
don00190  Oxidative phosphorylation
don00650  Butanoate metabolism
don01100  Metabolic pathways
don01110  Biosynthesis of secondary metabolites
don01120  Microbial metabolism in diverse environments
don01130  Biosynthesis of antibiotics
don01200  Carbon metabolism
Module
don_M00009  Citrate cycle (TCA cycle, Krebs cycle)
don_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
don_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:don00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSK21_11410
   00650 Butanoate metabolism
    BSK21_11410
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSK21_11410
Enzymes [BR:don01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BSK21_11410
    1.3.5.4  fumarate reductase (quinol)
     BSK21_11410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 DeoRC FAD_oxidored GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: APO87582
LinkDB All DBs
Position
complement(2290781..2292586)
Genome map
AA seq 601 aa AA seqDB search
MASYEYEVHEYDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASL
GNMGPDSWQWHMFDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGQ
CTGVVCWKLDDGTFHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDM
EFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTME
IREGRGVGKDGDHIHLHLNHLPAAALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYWGEVLNPTAKDPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
RAGKVVNPDSANPTLNQASIDKAFDRFDGLRHAKGNMATAELRLEMQKTMQSDAAVFRTA
ETMKEGVEKMTAIAAKMDDLSVTDRSLVWNSDLMETLELANLMPNALATIHGAEARKESR
GAHAHEDFPTRDDENWRVHTISRVDGNKVDLTYRPVVVDPLTTEAEGGISLKKIAPKART
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatacgaatacgaagttcacgaatacgacgtggtagttgtcggcgctggcggc
gctggcctccgcgcgaccctcggcatggccgaacaaggtctgcgcactgcgtgtatctct
aaggttttcccgacccgttcgcacacggttgcggcacagggcggtattgcggcatcgctg
ggcaacatgggtccagacagctggcagtggcacatgtttgacactgttaagggctctgac
tggctcggtgataccgacgcgatggaatacctcgcacgcgaagcccccaaagcggtttac
gagctagagcactacggcgttccgttctcgcggaccgaagaaggcaaaatctaccagcgt
ccgttcggtggtcacaccactgaattcggtgacggcccacccgttcagcgtacatgtgct
gcggctgaccgcaccggtcacgcgatcctgcacacgctctacggccaatcgctgaagaac
aacgcagagttctacatcgaatactttgcaatcgacctcatcatgtccgaagacggtcag
tgcactggcgttgtgtgctggaaactcgacgacggtacgttccacgtcttcaacgcaaag
atggtcgttctggcgactggtggttacggccgcgcatacttctcggcgacctcggcgcac
acctgcacgggtgacggcggtggcatggtggctcgcgctggtctggctctgcaggatatg
gaattcgttcagttccacccgaccggtatctatggctctggctgtctgatcaccgaaggt
gcacgtggcgaaggcggttatctgaccaactccgaaggcgagcgtttcatggagcgttat
gcgccccagtacaaagacctcgcaccgcgtgactacgtatcccgttcgatgactatggaa
atccgcgaaggccgtggcgtaggtaaggatggcgatcacatccacctgcacctcaaccac
cttcctgcggctgctctggcagaacgtctgccgggtatttccgagtccgcgaaaatcttt
gctggtgttgacgtgaccaaagagccgatcccggttctgcctacggttcactacaacatg
ggcggtattccgaccaactactggggcgaagtgctgaacccgaccgcgaaagacccgaac
gctgttgttccgggcctgatggctgttggtgaagctgggtgtgcctcggttcacggtgca
aaccgtctgggttcgaactctctgatcgacctcgttgtgtttggtcgtgcggctgcgatc
cgcgctggtaaggttgtgaacccagacagcgcgaacccgaccctgaaccaagcgtccatc
gacaaagcgttcgatcgctttgacggtctgcgtcacgcgaagggcaacatggcaactgca
gaactgcgtcttgagatgcagaaaaccatgcagtcggatgcagctgtgttccgtaccgct
gaaaccatgaaagagggcgtcgagaagatgaccgccattgctgcgaaaatggatgacctg
tcggtcaccgaccgcagcttggtctggaactctgacctgatggaaacgctcgagttggca
aaccttatgccgaacgctctggctaccatccacggcgctgaggcacgtaaggaatctcgc
ggtgcgcacgcacacgaggacttcccgacccgtgacgacgaaaactggcgtgttcacacc
atttcccgcgttgatgggaacaaggtggacctgacatatcgtccggttgttgtcgatccg
ctcaccaccgaagcggaaggcggtatcagcctcaagaagatcgcgccgaaagcacggacg
ttctaa

DBGET integrated database retrieval system