KEGG   Donghicola sp. JLT3646: BSK21_11480Help
Entry
BSK21_11480       CDS       T04589                                 

Definition
(GenBank) hypothetical protein
Organism
don  Donghicola sp. JLT3646
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG Rrp40_N MARVEL
Motif
Other DBs
NCBI-ProteinID: APO87596
LinkDB All DBs
Position
2305721..2306134
Genome map
AA seq 137 aa AA seqDB search
MTPELEALAYAALLQGIQFGWMSIRANLEVGPGVTTSPRDPDRLTKPLVEMVSTKTGRLF
RAMNNHFEALIMFTIAVLVVVLGDKTTGFSAACAWTYLAARVLYVPAYYFGWRPWRSLIW
MVGFLATMAMIASAILF
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaactcgaagccctcgcatatgctgctttgctgcaaggcatacagtttggc
tggatgtcgatccgtgccaacctcgaagtcggccccggtgtcacaacgagtccccgtgac
cctgatcgtttgaccaaacccttggtcgagatggtcagcaccaaaacgggtcgccttttc
cgcgccatgaacaaccacttcgaggcgctgatcatgttcaccatcgcggtccttgtggtc
gtgctgggagacaaaaccacaggattttctgcggcctgcgcttggacctacctcgcggcc
cgcgttctatacgttccggcttactatttcggttggcgcccatggcgtagcctgatctgg
atggtcggatttctcgcaacaatggcgatgattgcatctgccattctcttttga

DBGET integrated database retrieval system