KEGG   Donghicola sp. JLT3646: BSK21_12125Help
Entry
BSK21_12125       CDS       T04589                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
don  Donghicola sp. JLT3646
Pathway
don00240  Pyrimidine metabolism
don01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:don00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSK21_12125
Enzymes [BR:don01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BSK21_12125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: APO87712
LinkDB All DBs
Position
2432431..2433015
Genome map
AA seq 194 aa AA seqDB search
MAKLYFNYSTMNAGKSTILLQASHNYIERGMQTYLLTARFDDRAGAGRIASRIGIGADAD
TYTPESDLFAQIETRLNDGPCACVFVDEAQFLTETQVWQLARVVDDLNVPIMCYGLRVDF
QGKLFPGSAALLALADEMREVRTICHCGKKATMVVRKDENGVVVTDGAQVSIGGNDRYVS
LCRRHWREAVGDRG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttcaattattcgaccatgaacgctggcaagtcgacgatcctcttg
caagcgagtcacaactacatcgaacgcggaatgcagacctatctgctgacggcgcggttt
gatgatcgtgcaggcgctggccgcattgcgagccgcattggaatcggtgctgatgcagat
acctacacgcccgaaagcgatctctttgcccagatcgaaacccgactgaacgatggccct
tgtgcctgtgttttcgtggacgaagcgcagttcctgaccgaaacccaagtttggcaactc
gcccgcgtggtggatgatctgaacgtgccgattatgtgctacgggctgcgagtcgatttt
cagggtaagctgttccctggctcggccgctctgctcgcacttgcggatgaaatgcgtgaa
gtgcggacgatctgccactgcgggaaaaaggcgaccatggtcgttcgcaaagacgaaaac
ggcgtcgttgtgaccgacggtgcgcaggtttcgatcggcggcaatgatcgctacgtatcc
ctttgccgccgacattggcgcgaagccgtgggtgatcgcggttaa

DBGET integrated database retrieval system