KEGG   Desulfosporosinus orientis: Desor_1625
Entry
Desor_1625        CDS       T01675                                 

Definition
(GenBank) pyrrolysine biosynthesis protein PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00300  Lysine biosynthesis
dor01100  Metabolic pathways
dor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Desor_1625
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Desor_1625
SSDB
Motif
Pfam: Shikimate_DH AlaDh_PNT_C AdoHcyase_NAD 3HCDH_N DUF1188 Pyr_redox_2 Pyr_redox NAD_binding_7 2-Hacid_dh_C NAD_binding_8 ThiF ELFV_dehydrog GIDA HI0933_like DAO F420_oxidored adh_short TrkA_N adh_short_C2 NAD_Gly3P_dh_N FAD_binding_3 UDPG_MGDP_dh_N XdhC_C DUF43 Methyltransf_25 Pyr_redox_3 FAD_oxidored
Other DBs
NCBI-ProteinID: AET67270
UniProt: G7WEU1
LinkDB
Position
1710014..1710829
AA seq 271 aa
MTRLKHEDVAEISRQMSDYNSTLIQKTGCSLRELAAWAAGVHLDRELPQPKVAIIPMTCG
QGIIEGFSQSVAGIVQFLGFSPVITESRDAGGVAEAIEGGAEIIFMADDDRFVAVNVKSG
KVSDNGEATGKGYAMALEQMCRGLESKKALVIGAGPVGTGAAKALARSGAAVAVYDINPQ
MSKILADRLNKLGYNIMVETSLTDALNRYNLYFDACPAENVILTEHLKDDTMIAAPGIPL
GVEAAGLELIADRLIHDPLQIGVATMMFDVL
NT seq 816 nt   +upstreamnt  +downstreamnt
ttgacccgtttaaaacatgaagatgttgccgaaatttccaggcaaatgtcagactataat
tcaaccttaatccaaaaaaccggctgctctttaagagagcttgctgcttgggcagcaggc
gttcatcttgacagggaacttccccagccaaaagtagctattatacccatgacctgtgga
cagggaatcatagagggtttttcccagtccgtagctggaattgttcagtttctcggtttt
tccccggttattactgaaagccgggatgccgggggagttgccgaggctatcgaaggcggc
gctgaaatcatatttatggcagatgatgaccgcttcgttgcggtgaatgtaaaatccggc
aaggtctcagataacggagaggccacaggaaaaggatatgctatggctttggaacaaatg
tgtcgtgggttagagagcaaaaaggctttagtgattggtgccggaccggtaggtaccggc
gcagcgaaagccctggcccgctccggtgccgctgtggctgtttatgatattaatccgcaa
atgagcaagattctagcagatagattaaacaaactaggttataacattatggttgaaacc
agtttaacagatgctttaaatagatataacctttacttcgatgcttgtcctgctgaaaat
gtcattttgaccgaacatctgaaagacgatactatgattgctgctcccggtatcccttta
ggggtggaggctgcaggtctggagctgatcgcggaccgtttgattcacgatcccctgcaa
atcggggtagcgaccatgatgtttgatgtactgtaa

DBGET integrated database retrieval system