KEGG   Desulfosporosinus orientis: Desor_1676Help
Entry
Desor_1676        CDS       T01675                                 

Definition
(GenBank) menaquinone-dependent succinate dehydrogenase/fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00020  Citrate cycle (TCA cycle)
dor00190  Oxidative phosphorylation
dor00650  Butanoate metabolism
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desor_1676
   00650 Butanoate metabolism
    Desor_1676
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Desor_1676
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Desor_1676
    1.3.5.4  fumarate reductase (quinol)
     Desor_1676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like Pyr_redox AlaDh_PNT_C NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AET67316
UniProt: G7WEY7
LinkDB All DBs
Position
1764830..1766581
Genome map
AA seq 583 aa AA seqDB search
MSGKVIVVGGGLAGLMSVIKLAELGQKVDLFSLVPCKRSHSVCAQGGINAAVNTKGEGDS
TWEHFDDTIYGGDFLANQTPVKNMIEAAPSIIYLMDRMGVQFNRTPEGFLDVRRLGGAKY
SRTVFAGATTGQQLIYALDEQVRRYEDAGLVTRYEEWELLSLVLDEGICRGVVVQDLKSL
DIQVFGADAVILATGGPGMIYVRSTNSTINTGFAAASAYMQGGAYANGEFVQIHPSAIPG
RDKLRLMSESIRGDGGRVWVYRDGKPWYFLEDWYPAYGNMVPRDIATRAIFKVCVDMKLG
VDGENKVYLDITHLDPQEIDRKLEGVVDIYQKFIGDDPRQIPMQTFPAVHYSMGGLWVDY
NQMTNIPGLFAAGECEYQYHGANRLGGNSLVAALYAGMVAGPKAFEYCSGLKKRHEDLPK
ALFEKAQEQEAAKLTALFGMQGPENPYQLHQELGEWMVDNVTVVRENQRLWATDQKIQEL
MERYQKIGVGSSGAWGNQIVPFTRRLWGMLTLARVITLGAYHRNESRGAHYKPEYPERDD
ENWLKTTKAEWTAMGPRFSYEPVDTSFIKPRKRRYDVAKEVTV
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaaaagtgattgtagtcggaggcggtttggcgggcttgatgtccgtgatcaag
ctggctgagcttggtcaaaaggtggatttgttttctctggttccctgcaagcgatctcat
tccgtatgtgctcaagggggaatcaatgcagctgtaaatacaaaaggggaaggagactcc
acctgggagcattttgatgacacgatttatggaggggacttccttgccaaccaaactccg
gtgaagaatatgatcgaagctgctccgagcatcatttatctgatggatcgcatgggggtg
cagtttaaccggactccggaaggctttttggatgttcgccggctggggggagccaagtat
tcccggacggtttttgccggagcgaccaccgggcagcagctgatttatgccctggatgaa
caggtacgtcgttatgaggatgccggactggtcacgcgctacgaagaatgggaattgtta
tccctagtgctggatgaaggaatctgcaggggagttgttgtccaggacttaaaaagtctg
gatatccaggtttttggcgcggatgccgtgatcctggctacaggggggccgggaatgatt
tatgtgcgtagtacgaattcaactattaataccggatttgctgcagcctctgcctatatg
caagggggcgcttatgccaacggggaatttgttcaaatccatccttcggcaattcccggg
agggataagctacgtctgatgtcggagtccatccgtggggacggcggccgggtttgggtg
tacagagacggaaaaccctggtatttcttagaggattggtatcctgcctatggcaatatg
gtgcccagggatattgccacacgggctatctttaaagtttgtgtggatatgaagctgggg
gtggacggggaaaacaaagtctatctggatattactcatttggatcctcaggagattgac
cgcaaactggaaggggtggtggacatctaccaaaagtttatcggagatgatccccgccag
atacccatgcagacctttccggcagtgcattattccatgggagggctatgggttgattac
aatcaaatgactaatatcccgggcttatttgctgcgggagagtgtgagtatcagtatcac
ggtgccaatcgcttgggaggaaactccttggtagctgccttatatgcaggtatggttgcc
ggtcccaaggccttcgagtattgcagcgggcttaagaagcggcatgaggatttgccgaaa
gccctatttgaaaaagcgcaagagcaggaagcggccaaacttacagcattattcgggatg
caggggccggagaatccctatcaattgcatcaagagttgggagagtggatggtagataat
gtcaccgttgtccgggaaaaccagaggctgtgggcgacagatcaaaagattcaggagctg
atggagcgttatcagaagatcggagtgggcagctcaggggcctgggggaatcagattgta
ccctttacccgccgcctgtgggggatgcttaccttggccagggtgattaccttgggggct
tatcaccgcaatgaaagccgtggcgcccactacaagcctgagtacccggaacgggatgat
gagaattggcttaaaactactaaagcagaatggacggctatggggcctcgttttagttat
gaacccgtagatacaagctttattaaaccgcgcaagcggcgctacgatgtggcgaaagag
gtgacggtataa

DBGET integrated database retrieval system