KEGG   Desulfosporosinus orientis: Desor_1677Help
Entry
Desor_1677        CDS       T01675                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00020  Citrate cycle (TCA cycle)
dor00190  Oxidative phosphorylation
dor00650  Butanoate metabolism
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desor_1677
   00650 Butanoate metabolism
    Desor_1677
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Desor_1677
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Desor_1677
    1.3.5.4  fumarate reductase (quinol)
     Desor_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4_18 Fer4_7 Fer4_16 Fer4 Fer4_13 Fer4_2
Motif
Other DBs
NCBI-ProteinID: AET67317
UniProt: G7WEY8
LinkDB All DBs
Position
1766581..1767336
Genome map
AA seq 251 aa AA seqDB search
MTKEPTEIKLVIQRRSNPKANPYFEEFLIPYFPKMNVVAALMEIQKKPVNAKGEVTTPVV
WDCNCLEEVCGACTMVINGQARQACSALVDQLTQPIHLAPLSKFPVIKDLVVDRQVMFDN
LRKVKAWIEIDGTHEMGPGPKVSQKVQEQAYTLSKCMTCGCCMEACPNVNDKSKFIGPAP
IAQVDLMNSHPTGALQSEMRLEALMGEGGIADCGNAQNCIKACPKEIPLTRSIARLNRAT
TLQGIKSWFNK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggagcctacggagatcaaattagtgattcaacgccggtctaaccccaaagct
aatccctattttgaagagttcttaatcccctattttcccaagatgaatgtggtcgctgcc
ttgatggagattcagaaaaaacctgtcaatgccaaaggtgaggttacgacgcctgtcgtt
tgggactgcaattgccttgaagaagtgtgcggagcctgcactatggtgatcaatggtcag
gcccgtcaggcctgttctgccttagtggatcagctgacacaacctattcatctcgcccct
ctcagcaagtttcctgtgattaaagacctggttgtggaccggcaggtgatgtttgacaac
ctgcgtaaagtgaaagcctggattgaaatagacggtactcatgaaatggggccggggcct
aaagtttctcagaaagtgcaggagcaggcttacacactttccaaatgtatgacctgcgga
tgctgtatggaagcctgtcctaatgtcaatgacaaatcaaaattcatcggtcccgccccc
attgctcaggtggatttgatgaattcccatcccacaggggctttgcaatccgagatgagg
ctggaggctttgatgggtgaaggaggcattgctgattgcggcaacgctcaaaattgtatt
aaagcctgcccgaaagaaattcctctcactcgttctatagctcgtctgaaccgggcaacc
actctgcaggggatcaagagctggtttaataagtaa

DBGET integrated database retrieval system