KEGG   Desulfosporosinus orientis: Desor_1692Help
Entry
Desor_1692        CDS       T01675                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00020  Citrate cycle (TCA cycle)
dor00190  Oxidative phosphorylation
dor00650  Butanoate metabolism
dor01100  Metabolic pathways
dor01110  Biosynthesis of secondary metabolites
dor01120  Microbial metabolism in diverse environments
dor01130  Biosynthesis of antibiotics
dor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desor_1692
   00650 Butanoate metabolism
    Desor_1692
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Desor_1692
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Desor_1692
    1.3.5.4  fumarate reductase (quinol)
     Desor_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_17 Fer4_9 Fer4 Fer4_2 Fer4_16
Motif
Other DBs
NCBI-ProteinID: AET67332
UniProt: G7W5V6
LinkDB All DBs
Position
1786714..1787466
Genome map
AA seq 250 aa AA seqDB search
MAEQKTIRLKIRRQDGPDNPMRWEEFTIPYREKLNVISCLMEIQKNPITAEGKQTTPVVW
ECNCLEEVCGACTMNINGQAKQACSALIDQLDQPIILEPLMKFPIVRDLMVDRQIMFDHL
KTVRAWIPIDGTYNLGSGPRMPEVKRQWAYELSKCMTCGCCMEACPQVNIRSKFIGPSAI
SQVRLFNAHPTGEMNKHERLAPLLNEGGIADCGNAQNCVRACPKEIPLTTSLADINRETN
KFALNRWLRK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaaaaaaccatacgcttgaaaattcggcggcaagatggtccggataacccc
atgcgctgggaggaattcacaataccctatcgggaaaaattgaatgtgatctcttgttta
atggagattcagaaaaaccctataaccgcagaggggaagcaaaccactcctgtcgtatgg
gaatgtaactgtttggaagaagtttgcggggcgtgtacgatgaacattaacgggcaggca
aaacaagcatgttcagctctaatcgaccaactggaccagcctattatactcgaacctctg
atgaaatttccaattgttcgagatttaatggttgatcggcaaatcatgtttgaccatttg
aaaacagttcgtgcttggattcccatcgatgggacctataatttaggatctggtccgaga
atgcctgaggtaaaacggcaatgggcttatgagctgtcaaaatgcatgacctgtgggtgc
tgtatggaagcttgccctcaagttaatatacggtcaaaatttattggcccatcggctatt
tctcaagttcgcctatttaatgctcatccaacaggggaaatgaacaaacatgaacgattg
gcgcctttacttaatgaaggcgggattgctgactgtggcaatgctcaaaactgtgtaaga
gcttgcccgaaagagatacctttgacaaccagcttggcagacataaatcgtgaaaccaat
aaatttgcccttaatcgctggctaagaaaataa

DBGET integrated database retrieval system