KEGG   Desulfosporosinus orientis: Desor_4335Help
Entry
Desor_4335        CDS       T01675                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dor  Desulfosporosinus orientis
Pathway
dor00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Desor_4335
Enzymes [BR:dor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Desor_4335
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Desor_4335
    1.1.1.-  
     Desor_4335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_assoc 2-Hacid_dh_C Pyr_redox Pyr_redox_2 NAD_binding_7 DAO Sacchrp_dh_NADP Pyr_redox_3 ThiF AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AET69763
UniProt: G7WJA4
LinkDB All DBs
Position
complement(4491039..4492097)
Genome map
AA seq 352 aa AA seqDB search
MKAAVWYGRKDVRVVDVPEPPSPGEGWVKVRVEWCGICGSDLHEYLAGPIFIPAAEPDAL
TGSKAPLILGHEFSGEVVEIGPGVKNVQVGDRVAPDACQVCWECYHCKRMNYSMCEKLAF
TGLMTDGAFAEYVNVPAYTMYKIPDDMSYEAAAVIEPIAVGIHAVRQAPVIEGDKVVVLG
AGTIGLATLQAAKAAGASRVYVIEMAKARKEYALNMGATAVFDPREVDVVAKIKELTDGL
GADVTFECVGNEKTAPLAIQLARKSGKVVMVGIFERESSFNFFEVTANEKHIIGSLAYNG
EFATAIDLLNDGRLSAEPMITGKIKLEDIIEKGFDELVNRKEANIKILVSPR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtgtggtatggacgaaaagatgttcgggttgtagatgtgccggagccg
ccatcgccgggcgaagggtgggtaaaggttagggtggagtggtgcgggatctgtggttcc
gatctccatgaatatctggcaggtccgatttttattccggccgctgagcctgatgccctc
acgggcagtaaagccccccttattcttggccatgaattttccggagaagtggttgaaatt
ggtccgggagtcaagaatgttcaggtgggagaccgggttgccccagatgcttgccaagtg
tgttgggaatgttatcattgcaaacgcatgaattacagtatgtgtgaaaagttagccttt
accgggttaatgactgatggtgcctttgctgaatatgttaatgttccagcctatactatg
tataaaattccggatgatatgtcctatgaagcagctgcggtcatagagccaatagccgtt
ggaatccatgccgttcggcaggcaccggttattgaaggagataaggtcgttgttctgggt
gccggaacgattgggctcgcgactttacaggccgccaaggcagccggagccagtagagtc
tatgtgattgaaatggctaaggccagaaaagaatatgctctgaatatgggggcgacggca
gttttcgatccgagagaagtggacgttgtagccaagattaaggaacttactgatggatta
ggggcagatgttaccttcgaatgtgtcgggaatgagaagacagcacccctggccatacaa
ttggcgcgaaaaagcggcaaagtggtcatggtaggaatctttgaacgggaaagctcgttt
aacttttttgaggtaactgctaatgaaaaacacattataggatccttagcttataatgga
gagtttgctacagcaatagatttgttgaatgacgggcggctttctgccgaacccatgatt
acgggaaaaatcaaacttgaagatattattgaaaaaggattcgatgagctggtgaaccgg
aaagaggcaaatatcaaaatactggtttctccccgctaa

DBGET integrated database retrieval system