KEGG   Desulfosporosinus orientis: Desor_4726Help
Entry
Desor_4726        CDS       T01675                                 

Definition
(GenBank) protein kinase family protein with PASTA domain
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dor  Desulfosporosinus orientis
Brite
KEGG Orthology (KO) [BR:dor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dor01001]
    Desor_4726
Enzymes [BR:dor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Desor_4726
Protein kinases [BR:dor01001]
 Serine/threonine kinases: Other
  Bacterial family
   Desor_4726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Kinase-like RIO1 Haspin_kinase YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: AET70130
UniProt: G7WG36
LinkDB All DBs
Position
complement(4918236..4919987)
Genome map
AA seq 583 aa AA seqDB search
MSKIFGGRYEVLERIGAGGMAIVYKAKDLLLNRVVTIKVLREQFVTDEDFIRRFRREAQS
AASLSHPNIVSIYDVGKDGDTEYIVMEYVEGRNLKEIIREYAPLSTDQAINLARQITGAI
QNAHENHIIHRDIKPHNILVTAEGNVKVTDFGIARAVSSATVTHTGDIVGSVHYLSPEQA
KGIQSNERSDIYSLGIVLYELLTGKVPYDGETPIAIALKHLQQDPEPPSRLNPRISKDFE
AVIMRAISKSPEQRYSSAKELLEDLNNIQTGRPISWSGIFPADDLEKTQTHIGIVRAVAP
VDIKEPSPPKKVNKSRRLWIVGGLVLLLVLIGGGLLWNFIFVGTTTVPDLAGKTVPVAED
FIKSAQLTFNPDTDVTTQFSDDVDKDRIISQDPEAGSKVKVGRTVKIVVGKGVDIGQFPD
VKTGHMAKDNAIFLIQTAGFTGDINIVERMSPDVPKNAVIDQDPLPKATWPKNGNITLIV
SSGPELTTINMPNVIGKPSAEAQRILEDEYKLVLKVQSADSNMFPKDSVISTTPNPGESV
KQGSEVTMVVSRGPGPIAQGIMDHESIYRVLIAEALAVIPAKG
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaatcttcgggggacgatatgaggttttagagcggataggcgccggaggtatg
gcgattgtctataaagccaaagatcttttacttaaccgcgttgtgaccattaaggtgctc
cgggagcagtttgtcacagatgaagacttcattcgccgttttagaagggaagcccagtcc
gcggcaagtttgtctcatcccaatattgtctcgatttatgatgtgggcaaagacggggat
acggaatacattgtcatggaatatgtggaaggccggaatcttaaagaaattatccgtgag
tatgctcccctttctacggaccaggctattaatctggctcgccagattacaggggccatt
caaaatgcccatgagaaccacattattcatagggatatcaaacctcacaacatattggtg
acggcggaagggaatgttaaggttacagacttcggtattgcccgggctgtttcctcggcg
acggtaacccataccggcgatattgtagggtcggtgcattatttgtcaccggaacaggct
aaagggattcaaagcaatgagagatcggatatttattctttaggaattgttctctatgag
ttacttactgggaaggttccttatgatggggaaacacctatcgccattgctttaaaacac
ctgcagcaggacccggagccgcccagcaggctcaatcctcggatttctaaagactttgaa
gcagtgattatgcgggcgatttcaaaatctccggaacagcgatattcatcggccaaagag
ttattggaagatctgaacaatatccagaccggacggcccatttcctggtccggcatattt
cccgccgatgatctggagaagactcaaacccacatcgggatagtcagagccgtggctcct
gttgacatcaaagagcccagcccgcctaaaaaagttaataaaagccgcaggctctggatt
gttggtgggcttgtgcttctcttggtcttgattgggggtggtttgttatggaatttcatt
tttgtgggaacaaccactgttcctgatttagcagggaaaacagtgcctgtagccgaggat
tttattaagtctgcgcagctgacttttaatcctgacacggacgttaccacacaattcagt
gatgatgtcgacaaggaccgcattatttctcaggatcctgaggctggctccaaagtaaaa
gtgggccggactgtaaaaattgttgtgggcaaaggtgtggatatcgggcagtttccggat
gtgaagacaggtcatatggccaaagataatgccatctttttgattcaaactgccggattt
accggagatattaatattgttgagaggatgtcaccggatgttcccaaaaatgccgtgatt
gaccaggacccgctgcctaaagccacctggcccaaaaatggcaatattacactgattgtc
agcagcggaccggaactgacgacgatcaatatgcctaatgtcatcggcaaaccctctgca
gaagcccaaagaattcttgaggatgaatataagctggtgctcaaagttcaaagtgcggat
tccaatatgtttcccaaggattccgtgataagcacgacgcctaacccgggagaatccgtt
aaacagggatcagaagtaaccatggttgtttctcgcggaccggggccgattgctcagggc
atcatggaccatgaaagcatctatcgagtactcattgccgaggctttggctgtgatcccc
gcgaaggggtag

DBGET integrated database retrieval system