KEGG   Draconibacterium orientale: FH5T_00185Help
Entry
FH5T_00185        CDS       T03072                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dori  Draconibacterium orientale
Brite
KEGG Orthology (KO) [BR:dori00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FH5T_00185
Enzymes [BR:dori01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FH5T_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like GIDA FAD_binding_2 FAD_oxidored DAO Thi4 Thioredoxin_3 NAD_binding_8 NAD_binding_7 AlaDh_PNT_C Lycopene_cycl K_oxygenase FAD_binding_3 Thioredoxin_4 FMO-like Trp_halogenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AHW58506
UniProt: X5DW58
LinkDB All DBs
Position
31644..33203
Genome map
AA seq 519 aa AA seqDB search
MLQQTIKDKLQEVFSPLKNNYTFQVAVANSHPDKAQLTGLLDDVASTSEKINVTAEEGKG
LEFTILKNNTPTNIIFRAIPNGHEFPSLLTAILNLDGIGKNLPDEAVANQIKGLKGEIVL
KSYISLTCTNCPEVVQALNVLTLLNPNIRHEIIDGQINKEEVEALGIQAVPTVYANGEQL
HVGRSSIGELLAKLEDKVGSEPVASAPVEKEYDVVVVGGGPAGVSAAVYSARKGFSVALV
AEKVGGQLNETVSIENMISIPQTTGTKLSADLMSHLRDYPIDVLENRRVENVSLKDGLKE
VKTSLNETFKTPALIIATGASWRRLGVPGENEYIGSGVAFCTHCDGPFYKGKKVVVVGGG
NSGLEAAIDLSSIAAEVTVLEFMDELKGDQVLQDKLKTLPNVKIHTNAQTTAVKGDGNKV
IALEYKNRETEKTETITTDGVFVQIGLQANSKVFSEMVDTNRIGEIEIDAHCRTKQAGIY
AAGDVSVVPYKQIVIAMGEGSKAALSAFEDKIKNKLVQN
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttacaacaaaccattaaagataaattacaagaagttttcagcccgctaaaaaacaat
tacacctttcaggttgcagttgcaaattcacatccagacaaagcccaactaaccggtttg
ttggatgatgttgcatctacttctgaaaaaattaatgttactgctgaagaaggaaaaggg
ctggaatttactattttaaaaaacaatacgcctacgaatattatttttcgtgcaataccc
aacggacacgaatttccatcgttgttaaccgcaattttaaacctcgacggtattggcaag
aaccttcctgacgaagcggttgccaatcaaattaaaggattaaaaggcgagattgtgctg
aaaagctacatttccttaacctgcaccaattgccccgaagtggttcaggccttgaatgtt
ttaaccttgttaaacccaaatattcgtcacgaaattatcgacggacaaattaacaaggaa
gaagttgaagcgctgggaatacaagctgttccaacggtttacgccaatggcgaacaattg
catgtaggccgttcatcaattggtgagttgctggcaaaactggaagacaaagtaggatcg
gaaccggttgcaagtgcacccgttgaaaaagaatacgatgtagttgttgtaggcggcgga
cctgccggagtttctgctgcagtttattcagcacgaaaaggattttcggtagcattggtt
gccgagaaagttggaggccagctgaacgaaaccgtttcaatcgaaaacatgatttcgatc
cctcagactaccggaacaaaactttcggccgatttaatgagccacttaagagactaccca
atcgacgtacttgaaaaccgccgggttgaaaacgtatcattaaaagacggccttaaagaa
gtgaaaacttcgttaaacgaaacatttaaaactccggcactgattattgctaccggtgcc
agctggagacgtttgggcgttcccggagaaaacgaatacatcggttctggcgtggcattc
tgtacgcactgcgacggcccgttttacaaaggcaaaaaagtggttgttgtgggtggagga
aactctggcttggaagctgccatcgacctttcatcaattgcagccgaagttacagtgctt
gagtttatggacgagctaaaaggcgaccaggttctgcaagacaagctaaaaacattaccg
aatgtaaaaattcacaccaatgcgcaaacaactgccgttaaaggtgatggcaacaaagtt
atcgcattggaatacaaaaacagagaaacagaaaaaacagaaacaattaccactgatggc
gtattcgttcagattggattgcaagccaacagtaaggtattctccgaaatggttgatacc
aaccggataggagaaattgagattgacgcacattgccgtacaaaacaagcgggcatttac
gccgccggagatgtttcggtggtgccttacaaacaaattgtaattgcaatgggcgaagga
tcgaaagctgccctctcagcctttgaagacaagattaaaaataaactggttcagaattaa

DBGET integrated database retrieval system