KEGG   Draconibacterium orientale: FH5T_04430Help
Entry
FH5T_04430        CDS       T03072                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
dori  Draconibacterium orientale
Pathway
dori00500  Starch and sucrose metabolism
dori01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dori00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FH5T_04430
Enzymes [BR:dori01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     FH5T_04430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AHW59092
UniProt: X5DFC7
LinkDB All DBs
Position
1106568..1108703
Genome map
AA seq 711 aa AA seqDB search
MKRLLLILVLAVGTLFSHAEEITSPNGKMKLTFDLSDGTPVYKLQLEDKTIIKASKLGLE
LKDAEPLLSGFTLADSKTSAFDETWKPVWGEQSEIRNHYNELAVTLNQPATNRKMIIRFR
VFNDGLGFRYEFPEQENLIYFVVKDERTEFAMNGDHTAFWIPGDYDTQEYDYTQSKLSEI
RGLMEKAITPNTSQTPISATAVQTALMMKTNDGYYINLHEAALKDYSCMHLELDDKNMIF
KSVLTPDAQGNMAYMQAPCTTPWRTVIASKKAGDILLSNITLNLNEPCAYDNTDWIKPVK
YVGVWWEMITGKSSWAYTNLSSVKLGETDYSKTTPNGIHAANTAEVKKYIDFAAENGLDA
VLVEGWNEGWEDWFNKSKDYVFDFVTPYPDFNVAELRDYAKSKNIHLMMHHETSSSVRNY
ERHLDTAYQFMAENNYNSVKSGYVGDIIPRGEYHYGQWMVNHYLYAVKKAADYKIMVNAH
EAVRPTGLCRTYPNLIGNESARGTEYEAFGGNNVNHTTILPFTRLVGGPMDYTPGIFETH
VSEYNPDNNSQVRTTIARQLALYVTMYSPLQMAADLPTTYEKYMDAFQFIKDVALDWDKS
LVLEAEPGDYITYARKEKGSENWFVGRTNDQETRTSKISFDFLNPNQKYIATVYADAKDA
DWKTNPQAYEIKKYVVTSKSELKQQCAPGGGYAISIIPAANKAELKGLKKL
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattacttttgattcttgtgcttgccgttggcacactctttagccacgctgaa
gaaattacctctccgaacggaaaaatgaaacttaccttcgatttatcggatggaacaccg
gtttacaaacttcaattggaagacaaaaccattatcaaagccagcaaactcggtctcgaa
ttaaaagatgccgaaccactgttaagcggatttacccttgccgacagtaaaacctctgct
ttcgacgaaacctggaaaccagtttggggcgaacaaagcgagattcgtaaccattacaac
gaactggctgtaaccttaaaccaaccggctaccaaccgaaaaatgatcatccgtttccgt
gtttttaacgacggattgggttttcgttatgaattcccggagcaagaaaacctgatttat
tttgtggtgaaagacgaacgcactgagtttgccatgaatggcgaccacacggcgttctgg
attccgggcgattacgacacgcaggaatacgattacacccagtcaaaactgtcggaaatt
cgcggattgatggaaaaagccatcacaccaaacacatcgcaaacgcccatttcggcaaca
gctgtacaaacagctttaatgatgaaaaccaacgacggttactacatcaacctgcacgaa
gcagcactgaaagattattcgtgcatgcacctggaactcgatgataaaaacatgattttc
aaatcggttctaacacccgatgcacaaggaaatatggcctacatgcaggcgccttgcaca
acgccctggcgcacagtaatcgcaagcaaaaaggcaggcgatattttgctttcaaatatc
acccttaacttgaacgagccttgtgcatacgacaacaccgattggattaaaccggtaaaa
tatgttggcgtttggtgggaaatgattaccggaaaaagctcgtgggcatacaccaacctg
tcaagtgtaaaactgggcgaaacagactattcaaaaacaacacccaacggaattcatgct
gccaatactgcggaggtgaaaaaatacattgattttgcagcagaaaatggtttggatgcg
gttttggtagaaggctggaacgaaggctgggaagactggttcaacaaatcgaaagactat
gttttcgattttgtaacgccctaccccgattttaacgttgccgaactgcgcgactatgca
aaaagcaaaaatatacacctgatgatgcaccacgaaacatcgagttcggtgcgcaactac
gagcgccatttggatacggcataccagtttatggccgagaacaactacaactcggtaaaa
agtggttatgtgggcgatattattccgcgtggcgaataccattacggacagtggatggtg
aaccattatttgtacgcggtaaaaaaagcggctgattacaaaattatggtgaatgcacac
gaagcggttcgcccaaccggattatgccgaacttacccgaacctgattggcaacgaatcg
gctcgcggaaccgagtacgaagcttttggtggaaacaatgtaaatcacaccaccatccta
ccgtttacacgtttggttggtggcccgatggattatacgccgggaattttcgaaacgcat
gtgagcgaatataatcctgataacaattcgcaggtgcgtaccaccattgcacgccagctg
gccttgtatgttaccatgtacagtccgctgcaaatggctgccgatttaccaacaacgtac
gagaaatacatggatgctttccagttcataaaagatgtagcgctggattgggacaaatcg
ttggtattggaggcagaaccgggcgattacattacctacgcccgcaaagaaaaaggcagc
gaaaactggtttgtaggccgcacaaacgaccaggaaacccgcacctcgaaaatcagtttt
gattttctgaatccgaatcagaaatacattgcaacagtttatgccgatgcaaaagatgcc
gattggaaaaccaatccacaggcatatgaaatcaaaaagtatgtggtaacgagtaagtcg
gaattaaaacaacaatgtgctcccggcggcggttatgcaattagcattatcccggcggct
aacaaggcggagttgaaaggattgaagaagctgtaa

DBGET integrated database retrieval system