KEGG   Draconibacterium orientale: FH5T_12470Help
Entry
FH5T_12470        CDS       T03072                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
dori  Draconibacterium orientale
Pathway
dori00473  D-Alanine metabolism
dori01100  Metabolic pathways
dori01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dori00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FH5T_12470
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    FH5T_12470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dori01011]
    FH5T_12470
Enzymes [BR:dori01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FH5T_12470
Peptidoglycan biosynthesis and degradation proteins [BR:dori01011]
 Precursor biosynthesis
  Racemase
   FH5T_12470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C NAC
Motif
Other DBs
NCBI-ProteinID: AHW60154
UniProt: X5DGF6
LinkDB All DBs
Position
complement(2959076..2961541)
Genome map
AA seq 821 aa AA seqDB search
MKLTAKQISAAINGELFASSSLQDFTVSEIITDSRTFFGGTNAAFFALSGPVFNGHNYIA
QLRKKGVQLFIVSNKNFIDNKAGYILVKDTIVALQQLAAYNRNRFSQPVIGITGSNGKTI
VKEWLYDLLSTEFKIVRSPKSYNSQVGVPLSALLIDNQYDLALLEAGISEPNEMEKLAPI
VRPNIGILTNIGDAHQENFRSMEEKLSEKLKLFTGAKKLVFRSDRFYSENIAEFCLQNDI
EPINWSLKNNDAAIRFKCKIKTTTTEIEARINDVNYSFSIPFTDDSAIENACHCFATLIA
LKKNPKDFPAQFSKLQPVAMRLEIKQGINNCLLINDYYNSDLNSLSIALSVLKQQAAISH
LFKHVILSDIQQTGIETEELYSKVNQLLQEWGINKLTGIGKDLYQHQHIFEMECEFYANR
SEFEKQFVRSNYSSSAILIKGARQFELEKISALLQQKAHQTVLEINLNALIHNLNTFRKL
LKPETKIMVMVKAFSYGSGDVEIAMLLQHQNVDYLAVAVADEGVQLRNAGINIPILVMNP
EHDSFQNIIDFNLEPNIYSLQLLQQFSKVVIEFGINNFPIHIKIDTGMNRLGLKTKKEIE
EVIAFTKNNKHLKIQSVFSHLAGSDEAELDDFTQEQFLRYADLSALIENAFPYKINKHIL
NSAGIERFPQHQMDMVRLGIGLYGISQTGLSLQQISTLKTTVSQVKTVNTNETVGYNRKG
KIKYQSRVAVVPMGYADGINRRLGNGLGSALVNGQEARIIGNICMDMLMLDVTNLEVNPG
DSVEIFGPNISISKVAQLLETIPYEILTGISQRVKRVYLQE
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atcaaactgacggcaaaacaaataagcgccgcaataaatggcgagcttttcgcgtcctca
tccttacaggattttactgtttcagaaattattaccgacagccgtactttcttcggcgga
acgaacgctgctttttttgccttaagcggccccgtttttaacgggcacaattacatcgct
caactgcgcaaaaaaggtgttcagctatttatcgtttccaacaagaattttattgacaac
aaagccggctacattctggtaaaagacaccattgtcgcacttcagcaactagccgcttat
aaccgaaaccggttttcgcagcctgttatcggaattaccggaagcaatggcaaaaccatt
gtaaaagagtggttgtacgatttactttccacggagtttaaaattgtacgaagccccaaa
agctacaactcgcaggtaggtgttcctttatcggctttgttaatcgacaaccaatacgac
ctggccctgttagaggcaggaatttcggaacccaatgaaatggaaaagcttgcaccaatc
gttcggcccaacattggaattttaaccaacattggcgatgctcatcaggaaaatttccgc
tcgatggaggaaaaactgagcgaaaaattaaaactgtttacaggtgcaaaaaagttggta
tttcgttccgatcgcttctactccgaaaacatcgcagaattttgcttgcaaaatgatatt
gaaccaataaactggtcgttaaaaaacaatgatgcagctatccggtttaaatgcaaaata
aaaacgactactaccgaaattgaggcaaggattaacgatgtgaattattcattttcaata
ccattcaccgatgattcggcgattgaaaatgcctgtcattgttttgctacgctaattgct
ttgaagaaaaatccaaaagattttccggcgcaattcagcaaactgcaaccggtggctatg
cgcctcgagattaaacaaggcataaacaactgcctgctgataaacgactattacaattcg
gatttaaattcgctaagtatcgcgctctcggtactcaaacagcaagcggctataagccat
ttgtttaaacacgtaattttatctgacatccagcaaacaggtatcgaaactgaggaactg
tattcgaaagtaaaccagcttttgcaggaatggggaattaacaaactcaccggaattggc
aaagatctttaccaacaccagcatatttttgaaatggaatgcgagttttatgccaatcgc
agcgagtttgagaaacaatttgttcgaagcaactattcatcgtcggcaattttaataaaa
ggtgcccggcaatttgagctggagaaaatatcggcattattgcaacaaaaagcacatcaa
acggtgcttgagatcaacctgaatgcactgattcataaccttaatactttccgcaaactg
ctaaaacctgagactaaaataatggtgatggtaaaagctttttcgtatggtagcggtgat
gtggaaattgcaatgcttttacaacaccaaaatgtggattacctggctgtggctgtggcc
gacgaaggggttcaactgcgaaatgcaggcatcaacattccaattttagtgatgaatccg
gaacacgacagttttcagaacatcatcgattttaacctggaacccaacatttacagcctc
caactcttgcaacagttttcaaaagtggttattgaatttggcataaacaacttccccatc
cacataaaaattgatacggggatgaaccgcctgggcctgaaaacaaaaaaagagattgag
gaagtaatcgcatttacgaaaaacaataagcatttaaaaatacaatcggttttttcgcac
cttgccggaagcgacgaagcggagctggatgattttacccaggaacaattcctgcgatat
gcagatttatcggctttaattgaaaatgcttttccttacaaaattaacaagcacattctg
aactcggccggtattgaacggttcccgcaacaccagatggatatggtacgactgggaatt
ggcctttacggcatttcgcaaaccggattatcattgcaacaaatcagcacattaaaaacc
actgtttcgcaagtaaaaacggtcaatacaaacgaaaccgttgggtacaaccgcaagggg
aaaataaagtaccaaagccgggtagccgttgtgccaatgggttatgccgatggaattaac
cgccgactcggtaacggtttaggcagcgctttggttaacggacaagaggccagaataatc
ggaaacatttgtatggacatgctaatgcttgatgttacaaacctggaggtaaaccccggc
gacagcgttgaaatctttgggccaaatatttccatttcaaaagtggctcaactacttgag
acgataccttacgagattttaacaggaatatcgcagcgggtgaaacgggtgtatttgcag
gaataa

DBGET integrated database retrieval system