KEGG   Draconibacterium orientale: FH5T_12475Help
Entry
FH5T_12475        CDS       T03072                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
dori  Draconibacterium orientale
Pathway
dori00240  Pyrimidine metabolism
dori01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dori00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FH5T_12475
Enzymes [BR:dori01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FH5T_12475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK DUF777 Ribosomal_L37e DUF5589 FUR
Motif
Other DBs
NCBI-ProteinID: AHW60155
UniProt: X5DY35
LinkDB All DBs
Position
complement(2961541..2962122)
Genome map
AA seq 193 aa AA seqDB search
MFIERDVNSHKKVGTIEVVAGSMFSGKTEELIRRLKRAKIAKQKVEIYKPMVDVRYSETE
VVSHDENAIHSTPVENSANILLLAGDVDVIGIDEAQFFDKGLINVVNQLANMGIRVIVAG
LDMDFKGEPFGPIPGLMAVADYITKVHAICVRCGSIAQFSHRISEKEQVVLLGEKDIYEP
LCRRCYNKAHKEQ
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaaagagatgtaaacagccataaaaaagttggcaccattgaagttgttgcc
ggatcgatgttttccgggaagacggaagaattgatacggcggctgaaacgtgccaaaatt
gccaaacaaaaggtggaaatttacaagccaatggttgatgttcgttactcggaaacggaa
gtggtttcgcacgacgaaaatgcaatccactccactccggttgaaaactcggccaatatt
ctgttactggccggagatgttgatgtaattggaattgacgaagcccagtttttcgacaaa
ggcctgataaatgtggtaaaccaactggctaacatgggtattcgcgttattgttgccggg
ttggatatggattttaaaggcgaaccttttggcccgattccggggctgatggcggttgcc
gattacattaccaaagtacacgcgatttgcgttcggtgcggaagcattgctcaattctct
catcgtatttcggaaaaagagcaagtggttttgctgggcgaaaaagacatttatgaacca
ctttgccgacgctgttacaacaaagcacataaggaacaatga

DBGET integrated database retrieval system