KEGG   Draconibacterium orientale: FH5T_12535Help
Entry
FH5T_12535        CDS       T03072                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dori  Draconibacterium orientale
Pathway
dori00473  D-Alanine metabolism
dori00550  Peptidoglycan biosynthesis
dori01100  Metabolic pathways
dori01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dori00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FH5T_12535
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FH5T_12535
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FH5T_12535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dori01011]
    FH5T_12535
Enzymes [BR:dori01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FH5T_12535
Peptidoglycan biosynthesis and degradation proteins [BR:dori01011]
 Precursor biosynthesis
  Amino acid ligase
   FH5T_12535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AHW60163
UniProt: X5DBG9
LinkDB All DBs
Position
complement(2976931..2977920)
Genome map
AA seq 329 aa AA seqDB search
MSKNNKPHIAVIAGGDSSEFVVSVKSGANVLKAVDTEKFTPWLVQMQGLNWEVFQNEQKI
ADIDKSDFSFTINNDKIKFDFAYITIHGTPGEDGILQAYFELLKVPYSTCSVHSSSLTFN
KWFCNNYLRSHGIKMAVSKKFKKGEAVDAEAIVEDLGLPIFVKPNAGGSSFGITKVKETG
AVIAAIEKAWEESDEALVEQFIDGHEFTCGAVRLKEEKVVFPVTEVIPQNEFFDFEAKYT
PGAAQEITPARLPEPLFKKCQELTSKIYDLCECSGIVRIDFILQGEEFYFLEVNTTPGMT
ATSFIPQQISAMGSTLKSIITQIIEEKLG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaacaacaagccccatatagcggtaattgccggaggcgattcatcggaattt
gtggtgtcggtaaaaagcggagcaaacgttttaaaggctgtggatactgaaaaattcacc
ccgtggctggtgcaaatgcaggggctaaactgggaagtttttcaaaacgagcagaaaatt
gccgacatcgacaaatcggattttagttttaccataaacaacgacaagataaaattcgat
tttgcctacatcaccattcacggaacacccggcgaagacgggattttacaagcttatttc
gaattgctgaaagttccctactctacctgcagcgttcactcgtcgtcgcttacttttaac
aagtggttttgcaacaactacctgcgctcgcacggcattaaaatggccgtctcgaaaaag
ttcaaaaaaggcgaagcagttgatgccgaagcgattgttgaagatctgggattacccatt
ttcgtgaaaccaaatgccggaggttcaagctttggaattaccaaagtaaaagaaaccggc
gctgttatagccgccattgaaaaggcctgggaggaaagcgacgaggcattggtagaacaa
tttatcgacgggcacgagtttacctgcggcgccgttcgattgaaagaagaaaaagtggtt
ttcccggttaccgaagtaattccgcaaaatgaatttttcgatttcgaagcaaaatacacg
ccgggagctgcacaggaaattacgccggcaaggttgcccgaaccgcttttcaaaaaatgc
caggaactgacttcaaagatttacgacttatgcgaatgttccggaatcgttcgaatcgac
tttattttgcaaggagaagagttctatttcctggaagtaaacaccacgcccggaatgact
gccaccagctttattccgcagcaaattagcgcaatgggaagcacactaaaaagcattatt
acccaaataattgaagaaaaattaggctag

DBGET integrated database retrieval system