KEGG   Draconibacterium orientale: FH5T_13500Help
Entry
FH5T_13500        CDS       T03072                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dori  Draconibacterium orientale
Pathway
dori00564  Glycerophospholipid metabolism
dori01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dori00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FH5T_13500
Enzymes [BR:dori01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FH5T_13500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 HI0933_like Lycopene_cycl Thi4 Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHW60296
UniProt: X5E171
LinkDB All DBs
Position
complement(3196416..3197975)
Genome map
AA seq 519 aa AA seqDB search
MKRHKQLRKAKADIEWDIVVIGGGASGLGVALESATRKYKTLLLEGADFGKGTSSRSTKL
VHGGVRYLAQGDISLVLEALRERGLMLQNAPHLVKNQSFIIPNYEWWGGPFYTIGLKVYD
MMAGKLGLGPSVHLTKQETLEALPTLKEEGLTGGVIYHDGQFDDARLSINLAQTIIDYDG
VAVNYTKVIGLLKDKDGMICGVKAKDMIDGDEFEIRAKAVVNATGVFTDEILQMDEPGTP
KKVVPSQGIHLVLDHDFLKGDHAIMIPKTDDGRVLFAVPWRGKVVVGTTDTLIENASLEP
RALEEEIEFILSTAKRYLTRPPKRSDVKSIFAGLRPLAAPEGEDKKTKEISRSHKVIMSL
SGLITITGGKWTTYRKMGEDTINNAVILAGLPERPCQTENLAIHGYTKNIDHNDHFYVYG
SEAKEIKEMIENDPELGEKLHERLEFTVAEVVWACKKEMAITLDDVLARRVRALYLDARA
AEEMAPKVAQIMANELNKDTGWINQQVEEFTQIAKGYYL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacataaacaattacggaaagccaaagccgatattgaatgggatattgttgta
atcggcggtggtgcttcaggattgggagtcgcactcgaatcggctacccgaaaatacaaa
acactgctgctcgaaggggccgattttggcaaaggaacctcgagccgaagtaccaaactg
gtgcacggtggtgtgcgctatttggcacagggcgacatctcgctggttttggaagccctg
cgcgaacgcggattaatgctgcaaaatgcgcctcacctggtaaaaaaccagtcgtttatt
attcctaactacgaatggtggggcggccccttttacaccatcggcttaaaagtttacgac
atgatggccggaaaactgggactggggccttcggtgcacctcaccaagcaggaaacactg
gaagctttacccaccctgaaagaagaaggcttaacaggtggcgtgatataccacgacgga
caatttgatgatgcccgactttcgataaaccttgcacaaaccattattgattacgatgga
gtggccgtaaattataccaaagttattggtctgctaaaagacaaagatggaatgatttgc
ggggtaaaagccaaagatatgattgatggcgatgaatttgaaatacgagccaaagcagtg
gtaaacgcaaccggagtttttaccgacgaaattttacaaatggatgaacccggcactccc
aaaaaagtggtgcccagccagggaatccatcttgtactcgatcatgattttctgaaaggt
gaccatgcaataatgattcccaaaaccgatgacgggcgcgtgctttttgccgttccgtgg
cgcgggaaagtagtagttggcactaccgacacccttattgaaaatgccagccttgaacca
agagcactggaagaagaaattgagtttatactaagcactgccaaacgctaccttacacgc
cctccgaaaagaagcgatgtaaaaagtatttttgccgggctacggccacttgccgccccc
gaaggagaagacaaaaaaaccaaggaaatttcacgcagccataaagttatcatgagttta
tcggggctaattactattaccggcggaaaatggacaacctaccgcaaaatgggcgaagat
accataaacaatgccgttattttggctggcttacccgaacgcccctgccaaaccgaaaac
ctggccattcacggatacacaaaaaacattgatcataacgatcatttttatgtatatgga
tcggaagcaaaagaaattaaggagatgattgaaaacgatccggaattgggagaaaaactt
cacgaacggcttgagtttacggttgccgaagtggtttgggcttgcaaaaaagaaatggca
ataacacttgatgatgtactggctcgccgggtacgagctttatatctcgatgcgcgtgca
gccgaagaaatggcgcccaaagtggcacaaataatggcaaacgaattaaataaagatacc
ggttggattaatcaacaagttgaagaatttacccaaattgccaaaggttattacctctaa

DBGET integrated database retrieval system