KEGG   Draconibacterium orientale: FH5T_16050Help
Entry
FH5T_16050        CDS       T03072                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
dori  Draconibacterium orientale
Brite
KEGG Orthology (KO) [BR:dori00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dori03400]
    FH5T_16050
DNA repair and recombination proteins [BR:dori03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FH5T_16050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SbcCD_C AAA_23 SMC_N AAA_29 DUF4172
Motif
Other DBs
NCBI-ProteinID: AHW60637
UniProt: X5DJB8
LinkDB All DBs
Position
3804714..3807791
Genome map
AA seq 1025 aa AA seqDB search
MIPVQLTIQGLYSYQEKQTIDFTKLTAANLFGIFGTVGSGKSSILEAITFAIYGRTDRLN
LSGDNRYYNMMNLKSNELLIDFVFETGKEQTAYRATVKGKRNGKNFEDVKALDRSAYRKK
GNEWIPIATADLEQAIGLSYDNFKRTIIIPQGQFQEFLQLGNKDRTQMMKELFNLGKFEF
YYKVTSLESKNNAQKQNIEGQLQQLGSVDPEQLKVFKSQLVQLENELKKQNAKLTEYQKT
EEDLRKLQDLAKRKSEAEKAFKSLREQEPVFKQLEQKISRFEQCVIQFKHLLDGLKLTNE
KVQVREKQIKQDEVKQKLQESEIGTLNKKIEELNPAYEKREELKQKAEELGRLIQMKTLE
QTISIENGRLQKGTQVCNDYEKNLEQLKIQKQELEALIKFSKGKMPDLELLSAVKNWYTE
KHLLEKELPAIQKELEENQKTTSSLQNSVAKLLEEAGLTQLPEIEYSNILQILKDKTGKA
KEKQKALNEQESHIRVKEQLKAYSENMEDGAPCPLCGSVHHPDVLKTEDLNDTLLKLNVE
KQANEKEQEQLSDWISRINLLSKQQEMIHQQKNSLLQKQKAQQERIEAHAKKFTWEKYRV
ETELEKAFQEARRIQGELKKQDDLLEKLGKDIDKKGNDFKRFQVEVDKIRTVLTVQQTEL
KTLEKQLRLIKAETYQEVKIEQIEIEKSKLQKEHSQLEKSFSEITQQITEKSKLRDTLFG
SVQAGKKELEQEKQSLHKLRQQTKEQLEKSTYNSIDEVTAILSESFNPDTEKQRIAHFKD
QFLQAKSLLQQLQKDVGERIYDQETHQKLNADIALLKEHLARKNQEQGKIAEQLKKLQKD
LESQAALQKELEKLELRAENLKTIKSLFKASGFVNYISSVYLQNLCNAANDRFFQLTRQK
LSLEITPDNNFQVRDFMNGGKIRSVKTLSGGQTFQAAMSLALALADNIQKITESKQNFFF
LDEGFGSLDKESLGVVFDTLKSLRKENRIVGVISHVEEMQQEIDVHLRIDNQEERGSQIW
TSWME
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgatacccgtacaactcaccatacaaggtttgtattcctaccaggaaaagcaaaccatc
gattttacaaaactaacagctgccaatctgtttgggattttcggaactgtaggaagtgga
aaatcctcaattctggaagccattacttttgccatttacggccggactgaccggttaaat
ctttcgggagacaatcgttactacaacatgatgaacctgaaatcgaatgagttactcatc
gattttgtatttgaaactggtaaagaacaaacggcctatcgggcaacggttaagggcaag
cgtaacgggaaaaactttgaagatgtaaaagcgctggaccggtcggcttaccggaaaaag
gggaacgagtggattcccatcgcaacggctgacctggaacaggcaattggtttaagttac
gataattttaaacgtacgattatcattccgcagggacagtttcaggagtttctgcaattg
ggaaataaagaccggactcaaatgatgaaggaactttttaacctcgggaagttcgaattt
tattataaggtgacctcgctcgaaagcaaaaataatgcacaaaagcagaatattgaaggt
cagttgcagcagttgggaagcgttgatcctgaacaattgaaagtattcaaatctcaattg
gtgcaacttgagaatgaactcaaaaaacagaatgcaaaacttactgaatatcagaagaca
gaagaagatcttcggaaacttcaggacctggcaaaacgaaaatcagaagctgaaaaagca
ttcaaatccttgcgggaacaagagccggttttcaaacaattagagcagaaaatttctcgt
ttcgaacagtgtgtaattcagtttaaacatttgctggatggattaaaattgacaaatgaa
aaagtgcaggttcgcgaaaaacagattaagcaggatgaggtaaaacaaaagttgcaggag
agcgaaatcggaacattgaacaagaaaattgaggaactaaatcctgcttatgaaaaaaga
gaggagttaaaacaaaaggcagaagaacttggccgattgatacaaatgaaaacactggag
caaaccatttcaatagaaaatggtcggctacagaaaggaactcaggtttgcaatgattat
gaaaaaaatctggaacaattaaagattcagaaacaagagttggaggcgctgattaaattc
tcaaaagggaagatgcccgatctggaactgttatccgcggtgaaaaactggtacaccgag
aaacatcttctcgaaaaggaacttccggcaattcaaaaggagttggaagaaaatcaaaaa
acaacttcaagtctgcaaaattctgtggccaaactattggaagaagccggtcttacacaa
ctgccggaaattgaatattccaatatccttcaaatcttaaaggataaaacgggaaaagca
aaggaaaagcagaaagcactgaatgagcaggaaagtcatatacgtgtgaaagaacagttg
aaagcttattccgaaaatatggaagatggagcgccatgtccgctttgtgggtcggtgcat
caccccgatgttttaaaaaccgaagacctgaacgacacgttgttgaagcttaatgtagaa
aaacaggcaaacgaaaaggaacaggaacagctatcagattggataagccgcataaatctg
ctcagcaaacagcaagagatgattcatcagcagaaaaactctttgttgcaaaaacaaaag
gctcagcaggaaagaattgaggctcatgcaaagaaatttacctgggagaaatatcgcgtg
gaaaccgaactggaaaaggcgtttcaggaagcaaggcgtattcagggcgaattgaaaaag
caggatgatttactggagaagttagggaaggatattgataagaaagggaatgattttaaa
cggtttcaggtggaagtcgataagatcagaaccgttttaacagtgcagcaaactgaacta
aaaacgctggaaaagcaactgcggttgataaaagccgaaacttatcaggaagttaaaatt
gaacagattgaaatagaaaaaagtaagctgcagaaggaacatagccagttggaaaaatct
ttttccgaaataactcagcagataacggagaaaagcaaactgcgcgacaccttatttggt
tcggtacaggccggcaaaaaggaactggagcaggaaaaacaaagcctgcacaagctgcga
cagcaaacaaaggagcaactggaaaaatcgacgtataattccatcgatgaggttacggcg
atcttatcggaatcgtttaatccggatactgaaaaacaacgtatagctcattttaaagat
cagtttttgcaagcaaagtcgttattgcaacaattgcagaaagacgtcggcgaacgaatc
tatgaccaggaaacacatcagaaattaaatgcagacattgctttgttaaaggaacatctt
gcacggaagaaccaggagcagggaaaaattgcagagcagctaaaaaaactacaaaaagat
ttggaaagccaggctgctcttcagaaagaactagaaaagctggagttgcgggcagagaat
ctgaaaactataaaatcgttgttcaaagccagtggatttgtcaactacatttcgtctgtt
tacctgcaaaacttatgtaatgcagctaatgatcgtttctttcagctcacccggcaaaag
ctgagtttagaaatcacacccgacaacaatttccaggtgcgcgattttatgaatggtgga
aagatcagaagtgtaaaaacgctttccggcggacagacatttcaggcagccatgtcgctg
gctttagcgttggccgataatatccagaaaattaccgaatcgaaacaaaactttttcttc
ctcgacgaaggatttggttccctggataaagaatcgctgggagttgtttttgatacacta
aaatcgttgcgaaaagaaaatcgtattgttggtgttatttcacatgttgaagaaatgcag
caggaaattgatgttcaccttcgaatagataatcaagaggagcgtggaagccaaatttgg
acaagttggatggagtaa

DBGET integrated database retrieval system