KEGG   Draconibacterium orientale: FH5T_19435Help
Entry
FH5T_19435        CDS       T03072                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
dori  Draconibacterium orientale
Pathway
dori00061  Fatty acid biosynthesis
dori00780  Biotin metabolism
dori01100  Metabolic pathways
dori01130  Biosynthesis of antibiotics
dori01212  Fatty acid metabolism
Module
dori_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dori00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FH5T_19435
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FH5T_19435
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FH5T_19435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dori01004]
    FH5T_19435
Enzymes [BR:dori01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     FH5T_19435
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     FH5T_19435
Lipid biosynthesis proteins [BR:dori01004]
 Fatty acid synthase
  Component type
   FH5T_19435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short RNase_II_C_S1
Motif
Other DBs
NCBI-ProteinID: AHW61064
UniProt: X5DIX0
LinkDB All DBs
Position
4551989..4552864
Genome map
AA seq 291 aa AA seqDB search
MMNNLLKGKKGIIFGALNPDSIAWKVAVRAHEEGATVTLSNTPVAIRMGETNKLGEQINA
EVIGADATNVEDLENLIKKSMEVLGGKIDFILHSIGMSPNVRKGRHYSDLDYNYLDKTLD
VSAVSFHKVLQVARKMDAINEWGSVVALSYVAAQRSFFGYNDMADAKALLESIARSFGYI
YGRERNVRVNTISQSPTITTAGNGVKGFDRLLDFAERMSPLGNATGDECADYCITLFSDL
TKKVTMQNLFHDGGFSNMGMSLRALEQYEKGLDKICACDNDKPHADEHRYD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
attatgaataatctactaaaaggaaaaaagggaattatcttcggggcacttaatcccgat
tcaattgcctggaaagtggcagtaagagcacacgaagaaggagccacagtaacattatca
aataccccggttgccattcgtatgggcgagacaaataaactgggagagcaaattaatgcc
gaagttattggtgccgatgccaccaatgttgaagatctggaaaacctgataaaaaaatcg
atggaggttttaggtggtaaaatcgacttcattttacactctattggtatgtcgccaaac
gtaagaaaagggcgtcattacagtgatttggattataactacctggacaaaacacttgat
gtatcggcagtgtcgtttcacaaagtacttcaggtggcccgtaaaatggatgccattaac
gagtggggatcggtagttgccttgtcgtatgttgcggcacagcgttcgttctttggctac
aacgacatggccgatgctaaagccttgctggaatcgattgcacgtagtttcggttatatt
tacggacgtgagcgtaacgtaagggtaaataccatttcgcaatcgccaaccattaccact
gccggaaacggagtaaaaggtttcgaccgtttgctggacttcgccgaaagaatgtcgcca
cttggaaacgcaaccggcgatgagtgtgccgattactgtatcacacttttctctgattta
acgaaaaaggttaccatgcaaaaccttttccacgatggaggattctcgaacatgggaatg
agtttacgtgcattggagcaatacgaaaaagggttggataagatatgtgcatgcgacaat
gacaaaccgcatgcagatgaacatcgttacgactaa

DBGET integrated database retrieval system