KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0742500-01Help
Entry
Os01t0742500-01   CDS       T02163                                 

Gene name
Os01g0742500, HXK6, HEXOKINASE-6
Definition
(RAP-DB) Similar to Hexokinase.
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa00051  Fructose and mannose metabolism
dosa00052  Galactose metabolism
dosa00500  Starch and sucrose metabolism
dosa00520  Amino sugar and nucleotide sugar metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
Module
dosa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dosa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os01t0742500-01 (Os01g0742500)
   00051 Fructose and mannose metabolism
    Os01t0742500-01 (Os01g0742500)
   00052 Galactose metabolism
    Os01t0742500-01 (Os01g0742500)
   00500 Starch and sucrose metabolism
    Os01t0742500-01 (Os01g0742500)
   00520 Amino sugar and nucleotide sugar metabolism
    Os01t0742500-01 (Os01g0742500)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Os01t0742500-01 (Os01g0742500)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dosa04131]
    Os01t0742500-01 (Os01g0742500)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Os01t0742500-01 (Os01g0742500)
Membrane trafficking [BR:dosa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Os01t0742500-01 (Os01g0742500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF3824 FTZ
Motif
Other DBs
RAP-DB: Os01t0742500-01
Oryzabase: 9007
LinkDB All DBs
Position
chr01:complement(join(31013474..31013769,31012575..31012725,31012296..31012478,31011619..31011693,31011253..31011408,31011014..31011112,31010810..31010940,31010515..31010596,31010075..31010422))
AA seq 506 aa AA seqDB search
MGKGTVVGTAVVVCAAAAAAVGVAVVVSRRRRSKREAEEERRRRAAAVIEEVEQRFSTPT
ALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIRV
QLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELESFVKTEGEDFHLPEGRQREL
GFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAELSRAMERQGLDMKVTALVNDTV
GTLAGGRYVDNDVAAAVILGTGTNAAYVEHANAIPKWTGLLPRSGNMVINMEWGNFKSER
LPRSDYDNALDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPTKLEQR
FILRTPDMSAMHHDTSHDLKHLGAKLKDILGVADTSLEARYITLHVCDLVAERGARLAAA
GIYGILKKLGRDRVPSDGSQKQRTVIALDGGLYEHYKKFRTCLEATLADLLGEEAASSVV
VKLANDGSGIGAALLAASHSQYASVE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggggacggtagtggggacggcggtggtggtgtgcgctgcagcggccgcggcg
gttggggtggcggtggtggtgtcgcggaggaggaggagcaagcgggaggcggaggaggag
cggcggaggagggccgccgctgtgatcgaggaggtggagcagaggttctcgacgcccacg
gcgctgctgcgcggcatcgcggacgccatggtggaggagatggagcgcggcctccgcgcc
gaccctcacgccccgctcaagatgctcatcagctacgtcgacaacctccccaccggggat
gagcacggactgttctatgctctcgatcttgggggcaccaatttccgtgttatacgtgtt
cagcttggaggaagggaaaagcgtgttgttagtcaacagtacgaagaggttgccattcca
cctcacctgatggttgggacttctatggaactgtttgacttcattgcggctgagttggaa
agttttgtcaagaccgagggagaggatttccacttgccagagggcaggcagagagagtta
ggcttcaccttttctttcccagtgcaccaaacatcaatatcatcaggcactcttattaag
tggacaaagggattttccatcaatggcacggtgggggaagatgttgtggctgaattgagc
agggctatggaaaggcaagggcttgatatgaaagttacagctcttgttaatgacactgta
ggcacattggctggcggaagatatgttgataatgacgttgctgctgctgtaatattaggc
actggcacaaacgcagcctacgtggagcatgcaaatgcaattccaaaatggactggatta
ctacctagatcaggaaatatggtgattaacatggaatggggaaacttcaagtcagaaagg
cttcctcgttcagattacgataatgccttggactttgaaagtttaaacccaggcgagcag
atatatgaaaagatgatttccggcatgtatcttggagagattgtgcgcagaatcttgctt
aagcttgctcatgatgcttccttgtttggagatgttgttccaacaaagctggagcagcgc
tttatactgaggacgccggacatgtcagcgatgcatcatgatacctcacatgatctgaaa
cacctgggagctaagctgaaggatatcctgggggtcgctgatacttccctggaagcacga
tacatcacccttcatgtctgcgacctcgttgcagagagaggtgcacgcttagctgctgct
ggtatatatggcattctaaagaagctgggcagggacagagtgccaagtgacggtagtcaa
aagcagaggactgtcattgctctggatggtggtctctatgagcattacaagaagttcaga
acctgcctagaagcaacgcttgcagacctgcttggagaggaggctgcctcatcagttgtt
gtcaagttggcaaacgatggctctggcatcggagctgcacttcttgcagcatctcactcc
cagtatgctagcgtcgagtag

DBGET integrated database retrieval system