KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0152400-01Help
Entry
Os02t0152400-01   CDS       T02163                                 

Gene name
Os02g0152400
Definition
(RAP-DB) Similar to Ribulose bisphosphate carboxylase (EC 4.1.1.39) (Fragment).
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00630  Glyoxylate and dicarboxylate metabolism
dosa00710  Carbon fixation in photosynthetic organisms
dosa01100  Metabolic pathways
dosa01200  Carbon metabolism
Module
dosa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
dosa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
dosa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Os02t0152400-01 (Os02g0152400)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os02t0152400-01 (Os02g0152400)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Os02t0152400-01 (Os02g0152400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
RAP-DB: Os02t0152400-01
LinkDB All DBs
Position
chr02:join(2875087..2875242,2875403..2875534,2875680..2875943)
AA seq 183 aa AA seqDB search
MFINTASFVAGAVVASPEQPAKLVRDQRRVVPGSCRARRGAASNGFRTYCMQTWNPFTNR
RYEAMSYLPPLSAKSISKEIEFIMSKGWVPCLEFDKEGEIHRSNSRMPGYYDGRYWTLWK
LPMFGCSDAAAVLREVEECRREYPDAFIRLIAFDSSRQCQCMSFVVHKPPSAAASPATVA
GAE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcaacacggccagcttcgtcgccggcgccgtcgtcgcttcgccggagcagccg
gccaagcttgtccgggatcagaggagggtggtgcctggctcctgcagggcaagaagaggt
gcagcatccaatggcttcagaacttactgcatgcagacatggaaccctttcaccaacagg
aggtacgaggcgatgtcttacctgcctcccctgagcgcgaagtccatctccaaggagatc
gagttcatcatgtccaaaggatgggtcccttgcctcgagtttgacaaggagggggagatc
caccggagcaacagccggatgccggggtactacgacgggaggtactggacgctgtggaag
ctgccgatgttcggatgctctgacgcggcggcggtgctccgggaggtggaggaatgccgg
agggagtacccggacgccttcatccgcctcatcgccttcgacagcagccgccagtgccag
tgcatgtccttcgtcgtccacaagccgccgtcggccgccgcttctccggccacggtcgcc
ggagctgaatga

DBGET integrated database retrieval system