KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0244700-01Help
Entry
Os02t0244700-01   CDS       T02163                                 

Gene name
Os02g0244700
Definition
(RAP-DB) Similar to Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31) (PEPCase 1) (CP21).
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00620  Pyruvate metabolism
dosa00710  Carbon fixation in photosynthetic organisms
dosa01100  Metabolic pathways
dosa01200  Carbon metabolism
Module
dosa_M00168  CAM (Crassulacean acid metabolism), dark
dosa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
dosa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
dosa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Os02t0244700-01 (Os02g0244700)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os02t0244700-01 (Os02g0244700)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Os02t0244700-01 (Os02g0244700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
RAP-DB: Os02t0244700-01
LinkDB All DBs
Position
chr02:complement(join(8183819..8183998,8183326..8183717,8183152..8183236,8182228..8182450,8181802..8181905,8181626..8181713,8180700..8180854,8179618..8180616,8178722..8179108,8178053..8178346))
AA seq 968 aa AA seqDB search
MAAAAGKAAMERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREF
VQECYELSAEYENDRDEARLDELGRKLTSLPPGDSIVVSSSFSHMLNLANLAEEVQIAHR
RRIKLKRGDFADEASAPTESDIEETLKRLVTQLGKSREEVFDALKNQTVDLVFTAHPTQS
VRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEM
RAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTP
EVTRDVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRIRADDLHCSSRKAAKHYIEFW
KQIPPNEPYRVILGGVRDKLYYTRERTRHLLTTGVSEIPEEATFTNVEEFLEPLELCYRS
LCACGDKPIADGSLLDFLRQVSTFGLALVKLDIRQESDRHTDVLDAITTYLGIGSYAEWS
EEKRQDWLLSELRGKRPLFGPDLPQTEEIADVLGTFHVLAELPADCFGAYIISMATAPSD
VLAVELLQRECHIKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYMNRINGKQEVMIGYS
DSGKDAGRLSAAWQMYKAQEELVKVAKHYGVKLTMFHGRGGTVGRGGGPSHLAILSQPPD
TIHGSLRVTVQGEVIEHSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALMDEMAV
VATKEYRSIVFKEPRFVEYFRSATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWT
QTRFHLPVWLGFGGAFKHIMQKDIRNIHTLKEMYNEWPFFRVTLDLLEMVFAKGDPGIAA
LYDKLLVAGDLQSFGEQLRNNFEETKQLLLQVAGHKDILEGDPYLKQRLRLRESYITTLN
VCQAYTLKRIRDPSFEVMSQPALSKEFVDSNQPAELVQLNAASEYAPGLEDTLILTMKGI
AAGMQNTG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccgccgggaaggcggcgatggagcggcaccagtcgatcgacgcgcagctg
cggctgctcgcgccggggaaggtatccgaggacgacaagctcgtcgagtacgacgccctc
ctcgtcgaccgcttcctcgacatcctccaggacctgcacggccctcacctccgcgaattc
gtgcaggagtgctacgagctgtcggcggagtacgagaacgacagggacgaggcgcggctc
gacgagctggggaggaagctcaccagcctgccgccgggggactccatcgtcgtctccagc
tccttctcgcacatgctcaacctcgccaacctcgccgaggaggtgcagatcgcgcaccgc
cgccggatcaagctcaagcgcggggacttcgccgacgaggcctccgcgcccaccgagtcc
gacatcgaggagacgctcaagcgcctcgtcacccagctcggcaagtcgagggaggaggtg
ttcgatgcgctcaagaaccagaccgttgacctcgtgttcaccgcgcatccaacgcagtcc
gtcaggaggtccctgctccagaagcacgggaggatccggaattgcctgaggcagttatat
gcgaaagacatcactgctgatgacaagcaggagcttgatgaggccctgcagagggagatt
caagcagctttcagaactgatgaaatccgcaggactcctcccactcctcaggatgaaatg
cgcgccgggatgagttattttcatgaaactatatggaagggtgtaccaaagttcttgcgc
cgcattgatactgctctgaaaaatattgggattaatgagcgtcttccttacaatgctcct
ctcatccagttctcatcctggatgggtggtgaccgtgatggaaacccaagagttacacca
gaggttacaagagatgtatgcttgttggcaagaatgatggctgctaacctgtacttctct
cagatagaagatctgatgtttgagctctctatgtggcgctgcagtgatgaacttcgaatt
cgtgcagatgatttgcattgctcctccagaaaagctgcaaagcactatatagaattctgg
aagcaaattcctccaaatgagccttatcgtgtcatacttggtggtgtcagggataaattg
tactatacgcgtgaacgtactcgccatctattgacaactggagtttctgaaattccagag
gaggcaacgtttactaatgttgaagagtttctggagccgcttgagctgtgctacagatca
ttatgtgcttgtggtgacaaacctatagctgatggaagccttcttgatttcttgcgtcaa
gtatcaacttttgggctggctcttgtaaaacttgacataaggcaggagtctgatcgacac
actgatgtccttgatgccataactacatatcttgggattggatcttacgctgaatggtct
gaggagaaacgccaggattggcttttgtccgaactaaggggcaaacgtcctttgtttggt
cctgatcttcctcagactgaagaaattgctgatgttttaggaacatttcacgtccttgct
gagctcccggcagattgttttggtgcttacatcatctcaatggcaactgcaccatctgat
gtgcttgctgtggagcttctacagcgggagtgccatataaaacagcctctgcgagttgtt
cccctatttgagaaacttgcagatcttgaagcagctccagcagcggtggcacgactattt
tcaatagactggtacatgaataggattaatggcaagcaggaggtcatgattggatactca
gactctggcaaggatgctggtcgtctttctgcagcatggcaaatgtacaaagcacaagag
gagcttgtcaaggtggcaaagcattatggtgtaaagttgacaatgttccatggaagaggt
ggaacagttggcagaggaggtggtcccagtcatcttgccatattatctcaaccaccagac
acgatacatggatcacttcgtgtaacagtacagggcgaggttattgaacactcgtttgga
gaggaacacttgtgctttagaactctgcagcgctttactgcagctactcttgagcatgga
atgcatcctccaatttcccccaaaccagaatggcgtgctctaatggatgagatggctgtt
gtggcaacaaaggaatatcgatcaatcgtcttcaaggagccacggtttgttgaatacttc
cgatcggcaacacctgagacagaatatggcaggatgaacattggtagccgaccatcaaag
agaaagcctagtggtggcattgaatcgctccgtgcaattccttggatttttgcttggaca
caaactaggtttcatcttcctgtatggcttggatttggtggagcgttcaaacatataatg
cagaaggatatcaggaacatccatacactgaaagaaatgtacaatgagtggccattcttc
agggtcaccttggacttgcttgagatggttttcgccaagggagatccaggaattgctgct
ttatatgacaaattgcttgtggcaggtgatctgcaatcctttggagagcagctgagaaac
aactttgaagagacaaaacagctactccttcaggttgccggtcacaaggatattctggaa
ggggatccttacctgaagcagcgtctgcggctgcgtgagtcgtacatcactaccttgaac
gtttgccaagcctacaccctgaagcggataagggaccctagcttcgaggtgatgtcgcag
ccggccttgtcgaaggagttcgtcgacagcaaccagcctgccgagctggtccaactgaac
gctgcgagcgagtacgcacctggcctggaggacaccctcatcctgacgatgaagggcatt
gctgccggcatgcagaacacaggctag

DBGET integrated database retrieval system