KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0236200-01Help
Entry
Os03t0236200-01   CDS       T02163                                 

Gene name
Os03g0236200
Definition
(RAP-DB) Similar to Glutamate decarboxylase isozyme 3 (EC 4.1.1.15).
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00250  Alanine, aspartate and glutamate metabolism
dosa00410  beta-Alanine metabolism
dosa00430  Taurine and hypotaurine metabolism
dosa00650  Butanoate metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Os03t0236200-01 (Os03g0236200)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Os03t0236200-01 (Os03g0236200)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Os03t0236200-01 (Os03g0236200)
   00430 Taurine and hypotaurine metabolism
    Os03t0236200-01 (Os03g0236200)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Os03t0236200-01 (Os03g0236200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
RAP-DB: Os03t0236200-01
LinkDB All DBs
Position
chr03:join(7181276..7181361,7181474..7181678,7182331..7182746,7182833..7183139,7183230..7183694)
AA seq 492 aa AA seqDB search
MVLSKAVSESDMSVHSTFASRYVRASLPRYRMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFHAPLGEDETAVG
VGTVGSSEAIMLAGLAFKRRWQNKRKAEGKPFDKPNIITGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVDMVNENTICVAAILGSTLNGEFEDVKLLNDLLDKKNKETGWETP
IHVDAASGGFIAPFLYPELEWDFRLPWVKSINVSGHKYGLVYAGIGWCIWRNKEDLPEEL
IFHINYLGTDQPTFTLNFSKGSSQVIAQYYQLIRHGFEGYRNIMENCHENAMVLKEGLVK
TGRFDIVSKDEGVPLVAFSLKDRSRHDEFEISDMLRRFGWIVPAYTMPPDAQHVTVLRVV
IREEFSRTLAERLVLDIEKVMYQLDALPSRLMPPVPPAPLLVVAKKSELETQRSVTEAWK
KFVLAKRTNGVC
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctccaaggccgtctccgagagtgacatgtccgtgcactccaccttcgcctcc
cgctacgtccgcgcctccctcccaaggtaccggatgccggagaactcgatcccgaaggag
gcggcgtaccagatcatcaacgacgagctgatgctggacggcaacccgcggctgaacctg
gcgtcgttcgtcaccacgtggatggagcccgagtgcgacaagctcatcatggccgccatc
aacaagaactacgtcgacatggacgagtaccccgtcaccaccgagctccagaaccggtgc
gtgaacatgatcgcgcacctgttccacgcgccgctcggggaggacgagacggcggtgggc
gtgggcacggtgggttcgtcggaggccatcatgctggccgggctggccttcaagcggcgg
tggcagaacaagcgcaaggccgaggggaagccgttcgacaagcccaacatcatcaccggc
gccaacgtgcaggtgtgctgggagaagttcgcccgctacttcgaggtggagctcaaggag
gtgaagctccgcgacggctactacgtcatggaccccgagaaggccgtcgacatggtcaac
gagaacaccatctgcgtcgccgccatcctcggctccaccctcaacggcgagttcgaggac
gtcaagctactcaacgacctcctcgacaagaagaacaaggagactgggtgggagacgccg
atccacgtggacgcggcgagcggcgggttcatcgcgccgttcctgtacccggagctggag
tgggacttccggctgccgtgggtgaagagcatcaacgtgagcggtcacaagtacgggctc
gtctacgccggcatcggctggtgcatctggcgcaacaaggaggacctgcccgaggagctc
atcttccacatcaactacctcggcaccgaccagccaaccttcaccctcaacttctccaag
ggctccagccaggtcatcgcccagtactaccagctcatccgccacggcttcgaggggtac
aggaacatcatggagaactgccacgagaacgcgatggtgctgaaggaagggctggtgaag
acggggaggttcgacatcgtgtccaaggacgaaggggtgccgctggtggcgttctcgctc
aaggaccggagccggcacgacgagttcgagatctccgacatgctgcgccgcttcggctgg
atcgtgccggcgtacaccatgccgcccgacgcccagcacgtcacggtgctccgcgtggtc
atccgggaggagttcagccgcaccctcgccgagcgcctcgtcctcgacatcgagaaggtg
atgtaccagctcgacgcgctcccctccaggctcatgccccccgtgccgccggcgccgctg
ctggtggtcgccaagaagtcggagctcgagacgcagcggtcggtgacggaggcgtggaag
aagttcgtgctcgccaagaggaccaacggcgtctgctag

DBGET integrated database retrieval system