KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0351500-01Help
Entry
Os03t0351500-01   CDS       T02163                                 

Gene name
Os03g0351500, SODCC1, CYTOSOLIC_SUPEROXIDASE_DISMUTASE
Definition
(RAP-DB) Similar to Superoxide dismutase.
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Os03t0351500-01 (Os03g0351500)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Os03t0351500-01 (Os03g0351500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
RAP-DB: Os03t0351500-01
Oryzabase: 6431
LinkDB All DBs
Position
chr03:join(13182579..13182654,13182747..13182848,13182973..13183068,13183323..13183354,13183503..13183578,13184040..13184093,13184207..13184229)
AA seq 152 aa AA seqDB search
MVKAVVVLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTG
PHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgttgtgcttggtagcagtgagattgttaagggcactatccacttt
gtccaagagggagatggtcccaccactgtgactggaagtgtctctggcctcaagcctggt
ctccatgggttccatattcatgcacttggtgacaccaccaatggttgcatgtcaactggg
ccacactacaatcctgccggaaaggagcatggagcaccagaagatgagacccgccatgct
ggtgatcttggaaatgtcaccgctggagaagatggtgttgctaatatccatgttgttgac
agtcagattccacttactggaccaaattcaatcattggcagagccgtcgttgtgcatgcc
gatcctgatgatcttggaaagggtgggcacgagctgagcaagaccaccggaaacgctggt
ggccgtgttgcttgcgggatcatcggacttcaaggctga

DBGET integrated database retrieval system