KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0720300-01Help
Entry
Os03t0720300-01   CDS       T02163                                 

Gene name
Os03g0720300
Definition
(RAP-DB) Similar to Glutamate decarboxylase isozyme 1 (EC 4.1.1.15).
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00250  Alanine, aspartate and glutamate metabolism
dosa00410  beta-Alanine metabolism
dosa00430  Taurine and hypotaurine metabolism
dosa00650  Butanoate metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Os03t0720300-01 (Os03g0720300)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Os03t0720300-01 (Os03g0720300)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Os03t0720300-01 (Os03g0720300)
   00430 Taurine and hypotaurine metabolism
    Os03t0720300-01 (Os03g0720300)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Os03t0720300-01 (Os03g0720300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
RAP-DB: Os03t0720300-01
LinkDB All DBs
Position
chr03:join(29200510..29200592,29200688..29200895,29206436..29206636,29206710..29206924,29207074..29207327,29207459..29207511,29207881..29208345)
AA seq 492 aa AA seqDB search
MVLSHGVSGSDESVHSTFASRYVRTSLPRFRMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIQASVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRRWQNKMKAAGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPAKAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLTKKNAETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWCIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNIMENCQENAMVLKQGLEK
TGRFNIVSKDNGVPLVAFSLKDSARHNEFEISDFLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVLDVEKVLHELDALPARVVANGGDAAAASASEREMEKQREVISLWKR
AVLAKKKTNGVC
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcccacggcgtgtcgggctccgatgagtccgtccactccacgttcgcctcc
cgctacgtccgcacctccctccccaggttccggatgccggagcagtcgatccccaaggag
gcggcgtaccagatcatcaacgacgagctgatgctggacggcaacccgcggctgaacctc
gcgtcgttcgtcaccacgtggatggagcccgagtgcgacaagctcatccaggcctccgtc
aacaagaactacgtcgacatggacgagtaccccgtcaccaccgaactccagaaccgatgt
gtgaacatgattgcacacctcttcaatgctcctctaggggactctgaaacggccgtcgga
gtcggcactgtcggctcgtctgaggccatcatgctcgccggtttggccttcaagaggagg
tggcagaacaagatgaaggcagccggcaagccatgcgacaagcctaacattgtcaccggc
gccaatgtccaagtttgctgggagaagttcgcgcgatacttcgaggttgagctcaaggaa
gtgaagctgagtgacggctactacgtcatggacccagctaaggccgtggatatggtcgac
gagaacaccatctgcgtcgcggcgatcctcgggtcgacgctgaacggggagttcgaggac
gtgaagctgctcaacgatctgctcaccaagaagaacgctgaaacaggctgggacacgccg
atccacgtggacgcggcgagcggcgggttcatcgcgccgttcctgtacccggagctggag
tgggacttccggctgccgctggtgaagagcatcaacgtgagcgggcacaagtacggcctc
gtctacgccgggatcgggtggtgcatctggaggagcaaggaggatctgcctgaggagctc
atcttccacatcaactacctcggcgccgaccagcccaccttcaccctcaacttctccaag
ggttccagccaggtcattgcacagtattaccaactaatccgcctaggctttgaggggtac
aagaacatcatggagaactgccaggagaacgcgatggtgctgaagcaggggctggagaag
acggggcggttcaacatcgtgtccaaggacaacggcgtgccgctggtggccttctccctc
aaggacagcgcccggcacaacgagttcgagatctccgacttcctccgccgcttcggctgg
atcgtgccggcctacaccatgccccccgacgcgcagcacgtcaccgtgctccgcgtcgtc
atccgcgaggacttcagccgcacgctcgccgagcgcctcgtgctcgacgtcgagaaggtg
ctgcacgagctcgacgcgctccccgcccgcgtcgtcgccaacggcggcgacgccgccgcc
gcgtcggcgagcgagagggagatggagaagcagcgcgaggtgatctccctctggaagagg
gccgtgctggccaagaagaagaccaacggcgtctgctaa

DBGET integrated database retrieval system