KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0224900-01Help
Entry
Os04t0224900-01   CDS       T02163                                 

Gene name
Os04g0224900
Definition
(RAP-DB) FAD-dependent glycerol-3-phosphate dehydrogenase domain containing protein.
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00564  Glycerophospholipid metabolism
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Os04t0224900-01 (Os04g0224900)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Os04t0224900-01 (Os04g0224900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO_C DAO
Motif
Other DBs
RAP-DB: Os04t0224900-01
LinkDB All DBs
Position
chr04:complement(join(8312079..8312157,8310685..8311016,8310024..8310184,8309187..8309445,8307710..8308007,8307626..8307633))
AA seq 378 aa AA seqDB search
YAEVVSLIKDESGERIIGARIRDTLSGKEFDAFAKVVVNAAGPFCDSVRKMANNDVVPMI
SPSSGVHIVLPDYYSPDGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSSTAITMLPEPHE
DEIQFILDAICDYLNVQVRRSDVLSAWSGIRPLAMDPSAKNTESISRDHVVFEDYPGLIT
ITGGKWTTYRSMAEDAVNAAIRSGNLKPANGCVTDHLHILGGYGWDPASFTVLAQNYKRM
KRTYGGKIIPGAMDSAVSKHLSHAYGTLATQVASIAQNEGLGKRLAHGYPFLEAEVAYCA
RHEYCESAVDFIARRCRLAFLDTDAAGRALPRIIEILALERKWDKARQKLELQKGKDFLE
TFKSSKNAQFRDGKHNGQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
tatgctgaagtggtatccctcattaaggatgaatctggagaaaggattattggtgcacgg
atccgtgatacgctatcaggtaaagaattcgatgcatttgcaaaggtggttgttaacgca
gcaggaccgttctgtgactctgtgaggaagatggctaacaatgacgtagtgcccatgatc
agtccaagcagtggagtgcacattgtacttcctgattattattcccctgatgggatgggg
ctaattgtccctaaaaccaaggatggtagagttgtatttatgctgccatggttaggaagg
acagtagctggtacaaccgactctagtacagcaataacaatgcttcctgaaccacatgag
gatgagatacagttcatattagatgctatctgtgattatcttaacgttcaggtaaggcgt
tcagatgttctttctgcctggagtggtatacgtccactggctatggatccatcggcaaaa
aatactgagagcatttccagagatcatgttgtatttgaagactacccaggactaataact
atcactggtggaaaatggacaacttatagaagcatggctgaagatgctgttaatgcagcc
ataaggtcaggtaatttgaagcctgccaatggctgtgtgactgatcatctgcatattctt
ggtggatatggttgggatcctgcttcgtttactgtccttgcacagaactataaacggatg
aaaaggacatatggtgggaagatcattccaggtgcaatggacagtgctgtatcgaagcat
ctgtcacatgcatatggaactttggctacacaagtggcttcaattgcccagaatgaaggc
ttggggaagcgacttgctcatggatacccatttttggaggctgaagtagcatactgtgct
cgccacgagtactgtgaatctgctgtggacttcattgcaaggagatgccgtcttgcattt
cttgacacagatgctgctgggagagcattgcctcggatcatcgagattttagctctggaa
cgcaagtgggacaaggcaaggcagaagcttgaactacaaaagggtaaagatttcctggaa
acattcaagtcatccaagaatgcacaattcagggatggcaaacataatggtcaatga

DBGET integrated database retrieval system