KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0447400-01Help
Entry
Os04t0447400-01   CDS       T02163                                 

Gene name
Os04g0447400
Definition
(RAP-DB) Similar to Glutamate decarboxylase 2 (EC 4.1.1.15) (GAD 2).
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00250  Alanine, aspartate and glutamate metabolism
dosa00410  beta-Alanine metabolism
dosa00430  Taurine and hypotaurine metabolism
dosa00650  Butanoate metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Os04t0447400-01 (Os04g0447400)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Os04t0447400-01 (Os04g0447400)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Os04t0447400-01 (Os04g0447400)
   00430 Taurine and hypotaurine metabolism
    Os04t0447400-01 (Os04g0447400)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Os04t0447400-01 (Os04g0447400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
RAP-DB: Os04t0447400-01
LinkDB All DBs
Position
chr04:complement(join(22316031..22316318,22315537..22315952,22315187..22315440,22315050..22315102,22314426..22314869))
AA seq 484 aa AA seqDB search
MALSTAQTGESMHSSTFASRYVRTALPRFRMPEKSIPKDAAYQIINDELMLDGNPRLNLA
SFVTTWMEPECDKLMMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIGDDETAVGV
GTVGSSEAIMLAGLAFKRKWQNRMKAEGKPHDKPNIVTGANVQVCWEKFARYFEVELKEV
KLTQGYYVMNPEKAVEMVDENTICVAAILGSTLNGEFEDVKMLNDLLTAKNAETGWNTPI
HVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRNKEDLPDELI
FHINYLGADQPTFTLNFSKGSNQIIAQYYQLIRLGFEGYKDIMQNCRDNATVLREGIEKT
GHFDVVSKDSGVPLVAFSLKDSSRYTVFEVAESLRRFGWIVPAYTMPADAEHVAVMRVVI
REDFSRGLAERLITDLTKTVADMDAHAVKKAAAEPAKKTVREIEKEVTTYWRSFVARKKS
SLVC
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtcgacggcgcagacaggggagtcgatgcactcctcgacgttcgcgtcgcgg
tacgtgcgcacggcgctgccgaggttcaggatgccggagaagtcgatccccaaggacgcg
gcgtaccagatcatcaacgacgagctgatgctcgacggcaacccgcgcctgaacctggcg
tccttcgtcaccacgtggatggagcccgagtgcgacaagctcatgatggccgccatcaac
aagaactacgtcgacatggatgagtaccccgtcaccaccgagctccagaaccggtgcgtg
aacatgatcgcgcatctgttcaacgcgccgatcggggacgacgagacggcggtcggggtg
ggcacggtggggtcgtcggaggccatcatgctggcggggctggcgttcaagaggaagtgg
cagaacaggatgaaggccgaggggaagccccacgacaagcccaacatcgtgacgggggcc
aacgtgcaggtgtgctgggagaagttcgcgcgctacttcgaggtggagctcaaggaggtg
aagctgacccaagggtactacgtgatgaacccggagaaggccgtggagatggtcgacgag
aacaccatctgcgtcgccgccatcctcggctccaccctcaacggcgagttcgaggacgtc
aagatgctcaacgacctcctcaccgccaagaacgccgagacagggtggaacacgccgatc
catgtggacgcggcgagcggcgggttcatcgcgccgttcatctacccggagctggagtgg
gacttccggctgccgctggtgaagagcatcaacgtcagcggccacaagtacgggctcgtc
tacgccggcgtcgggtgggtcatctggcgcaacaaggaggacctccccgatgagctcatc
ttccacatcaactacctcggcgccgaccagccaaccttcacgctcaacttctccaaagga
tcgaaccagataattgcgcagtattaccagctcattcgtctcggattcgaggggtacaag
gacatcatgcagaactgccgggacaacgcgacggtgctccgggaggggatcgagaagacg
ggccacttcgacgtggtgtccaaggactccggcgtgccgctggtggccttctccctcaag
gactcgtcgcggtacacggtgttcgaggtggccgagagcctccgccgcttcggctggatc
gtgccggcgtacaccatgcccgccgacgctgagcacgtcgccgtgatgcgcgtcgtcatc
cgcgaggacttcagccgcggcctcgccgagcgcctcatcaccgacctcaccaagacggtg
gccgatatggacgcccacgccgtcaagaaggccgccgccgagccggccaagaagaccgtg
cgggagatagagaaggaggtgaccacctactggcggagtttcgtcgccaggaagaagagc
agcctcgtctgctga

DBGET integrated database retrieval system