KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0270900-01Help
Entry
Os06t0270900-01   CDS       T02163                                 

Gene name
Os06g0270900
Definition
(RAP-DB) Similar to RF2 (EC 1.2.1.3) (T cytoplasm male sterility restorer factor 2).
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa00053  Ascorbate and aldarate metabolism
dosa00071  Fatty acid degradation
dosa00280  Valine, leucine and isoleucine degradation
dosa00310  Lysine degradation
dosa00330  Arginine and proline metabolism
dosa00340  Histidine metabolism
dosa00380  Tryptophan metabolism
dosa00410  beta-Alanine metabolism
dosa00561  Glycerolipid metabolism
dosa00620  Pyruvate metabolism
dosa00903  Limonene and pinene degradation
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os06t0270900-01 (Os06g0270900)
   00053 Ascorbate and aldarate metabolism
    Os06t0270900-01 (Os06g0270900)
   00620 Pyruvate metabolism
    Os06t0270900-01 (Os06g0270900)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Os06t0270900-01 (Os06g0270900)
   00561 Glycerolipid metabolism
    Os06t0270900-01 (Os06g0270900)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Os06t0270900-01 (Os06g0270900)
   00310 Lysine degradation
    Os06t0270900-01 (Os06g0270900)
   00330 Arginine and proline metabolism
    Os06t0270900-01 (Os06g0270900)
   00340 Histidine metabolism
    Os06t0270900-01 (Os06g0270900)
   00380 Tryptophan metabolism
    Os06t0270900-01 (Os06g0270900)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Os06t0270900-01 (Os06g0270900)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Os06t0270900-01 (Os06g0270900)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Os06t0270900-01 (Os06g0270900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
RAP-DB: Os06t0270900-01
LinkDB All DBs
Position
chr06:join(9091242..9091350,9092953..9093090,9093308..9093450,9093545..9093698,9093793..9094022,9094565..9094654,9094789..9094962,9095056..9095193,9095395..9095532,9095633..9095694,9095927..9096200)
AA seq 549 aa AA seqDB search
MAAAAARRGSSLLSRCLLSRPAAAASPAVPSALRRADGTQGLLPGILQRFSTAAVAEEPI
SPPVQVNYTQLLIDGKFVDSASGKTFPTLDPRTGELIAHVAEGDAEDINRAVHAARKAFD
EGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYAQAANIEVPMVARLMRYY
AGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVLK
TAEQTPLSALFASKLLHEAGLPDGVVNVVSGFGPTAGAALASHMDVDKIAFTGSTDTGKV
VLELAARSNLKSVTLELGGKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHE
RIYDEFVEKAKARALKRVVGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGD
RLGDKGYYIQPTIFSDVQDNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVF
TNNLNTANTLTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVV
TPIKNAAWL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctgctgcaaggaggggctcatcgctgctctctcgctgcctgctgtccagg
cccgccgccgccgcctcgcctgctgtcccctctgcgctccgcagggcagatgggacacaa
ggattgttgccgggaatccttcagaggttcagcactgcagcagtagcagaggagcccata
tcacccccagtccaagtgaactacactcagctcctcattgatggaaaattcgttgattca
gcatctggcaaaactttcccaactctggaccctcgtaccggggagctgattgcccatgtg
gctgaaggcgatgcggaggatattaaccgtgcggttcatgcggcccgcaaggctttcgat
gaagggccatggccaaagatgactgcctatgagagatcccggattctgttgcggtttgct
gacttgattgagaagcacaacgatgaaattgctgcattggagacatgggacaacggcaag
ccgtatgcgcaagctgccaacattgaagtgccaatggtggcacggctgatgcggtactat
gctggttgggctgacaagatccatgggcttgtcgtgccggctgacggcccacaccatgta
caggtgctgcacgagcccattggtgtcgcaggtcagatcatcccatggaactttccgctt
ctgatgtttgcgtggaaagttggccctgctttggcttgtggaaacactgttgtgctcaag
acggctgagcaaactcctctgtctgctctatttgcttctaagctgttgcatgaggctgga
ctcccagacggtgttgttaacgtggtatctggttttggacctactgctggtgctgctctt
gctagtcacatggatgtcgataagattgcattcactggatcgaccgatactggaaaagtc
gtccttgagttggctgcaaggagcaaccttaagtcagtgacactggagctaggaggcaag
tctcctttcatcatcatggatgatgctgatgttgaccatgctgttgagcttgcgcatttt
gcactgttctttaaccagggacaatgttgctgtgctgggtctcgtacatttgtgcatgag
cgtatctatgatgagttcgtggagaaggccaaggctcgtgctctcaagcgtgtggttggt
gatccattcaagaatggtgttgaacagggccctcagattgatgacgagcaattcaacaag
atcttgcgctacatcaagtatggtgttgacagtggagccaaccttgtgactggtggcgac
agattaggtgacaaaggttactacatccagccaacaattttctcggatgtacaggataac
atgaggattgctcaagaagagatatttggccctgtgcagtccattctgaagttcaatgat
ctgaacgaggtcatcaagagggcaaatgcaagccagtacgggctggctgctggggtcttc
accaacaacctgaacacggccaacaccctgacccgcgcgctcagggtcgggaccgtgtgg
gtgaactgcttcgacgtcttcgacgccgcgatcccgttcggcggatacaagcagagcggc
atcgggagggagaagggcatcgacagcctgaagaactacctgcaggtcaaggccgtcgtc
acgccgatcaagaacgccgcgtggttgtaa

DBGET integrated database retrieval system