KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0275500-01Help
Entry
Os06t0275500-01   CDS       T02163                                 

Gene name
Os06g0275500, CURLY_LEAF, CLF
Definition
(RAP-DB) Similar to Polycomb protein EZ1 (Enhancer of zeste protein 1).
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Os06t0275500-01 (Os06g0275500)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dosa03036]
    Os06t0275500-01 (Os06g0275500)
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Os06t0275500-01 (Os06g0275500)
Chromosome and associated proteins [BR:dosa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Os06t0275500-01 (Os06g0275500)
   Polycomb group proteins
    PRC2-EZH2 complex
     Os06t0275500-01 (Os06g0275500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
RAP-DB: Os06t0275500-01
Oryzabase: 8839
LinkDB All DBs
Position
chr06:join(9354006..9354027,9354128..9354231,9354340..9354659,9355450..9355611,9356334..9356418,9356535..9356684,9356771..9356818,9356888..9356956,9357080..9357783,9358609..9358744,9358819..9359039,9359538..9359669,9360499..9360589,9361061..9361108,9361187..9361315,9361540..9361809)
AA seq 896 aa AA seqDB search
MAGDSRNEPMFCEEGSSESGYVLCVIDSLKKKITSDRFVYIQKRVEENSIKLSPITLHSH
NLSKNRQTSTSNSTDLVSNLLTKRKEDALCAVNSRESSPDESEGANCQDECSSTVIVGGN
LSARNSVRPIRLPEVATLPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDS
EDEAVEDEEEKKEFKDSEDCIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILQGE
KPEGSSKKVSELNVKMEDVYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEK
QAPLCSSDEGTPCGIHCYKLVSKPDAIMEIDSHLLVDVEEPTSDNLKDQIGSNKKKLGSS
GQKTKSQQSESSSTARVSSESSESEVQLLSNKSPQHSPGLSKNKLGAKGGIKKSTNRRIA
ERILMSVKKGQQEMSPDSNSIVNGCHWPRDMKLRSDTRSGIKDSVVSSQCNSPSTRSFRK
KGTLQMENNSSFVDAQSDSMEDTNNEHSATDGCDSSRKEECVDESICRQEAHGRSWKVIE
QGLLLKGLEIFGKNSCLIARNLLGGMKTCTDVFQYMNYIENSSASGALSGVDSLVKGYMK
GNELRTRSRFVRRRGRVRRLKYTWKTAGYHFIRKRITERKDQPCRQYTPCGCQSACGKQC
PCLTNGTCCEKYCGCPKMCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVGCG
DGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGEL
ISHKEADKRGKIYDRENSSFLFNLNNEYVLDAYRMGDKLKFANHSPDPNCYAKVIMVAGD
HRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEGPGAKDDAQPSTGRAKKLAH
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgattcccgaaatgagccgatgttttgcgaggaagggagcagtgaatcgggc
tatgttctatgtgttattgattcgctgaagaagaaaatcacatcggaccgctttgtttac
atccagaaaagggtagaggagaatagcattaagcttagcccgattacactgcactctcac
aatttgtcaaaaaataggcaaactagtacatccaacagtacagatttagtctcgaatttg
ctcacaaagaggaaagaagatgccctgtgtgctgtgaatagtcgtgagtcatctcctgat
gaaagtgaaggtgccaattgccaagatgagtgttcatcgactgttattgtgggtggaaat
ctatccgcgaggaattctgtccgtccgattagactaccagaagtggcaacactccctcca
tatacaacttggatatttttggacaggaaccagcggatgcaagaagaccaatctgtactt
ggtcgtcgaaggatttactatgatacaaactgtggcgaagctttaatttgcagtgatagt
gaagatgaagctgttgaggacgaggaagagaaaaaggagttcaaggattctgaagattgc
ataattcggatgaccattcaagaatgtggcatgtctgatgctgtgcttgaaactctagct
cgagatatcgaaagggctcctgatgatataaaggccaggtatgagatcctacaaggggag
aaacctgagggttcttccaagaaagtgtctgaacttaatgtcaaaatggaagacgtgtac
ggtgataaagatctggatgcagcattggattcctttgacaatctcttttgtcgccgatgt
ttggtttttgattgcaagctacatgggtgttctcaagatttagtatttccgactgaaaag
caggcaccattgtgcagctcggatgagggtacaccatgtggtattcactgttacaaactg
gtctctaaaccagatgctatcatggagattgattctcatttgcttgttgatgttgaggag
ccaacatcggacaatctaaaggatcagatagggtcaaataagaaaaagcttggttctagt
gggcagaaaacaaaatctcaacaaagtgaaagttcttcaactgcaagggtttcctcagaa
agcagtgagtctgaagtacaactgttaagcaataaatccccgcaacactctcctggcctc
tcaaaaaataagcttggcgcaaaaggtggaatcaagaaaagtactaacagaagaattgct
gagagaattctaatgagtgtgaaaaaggggcaacaggaaatgtcaccggactctaattct
attgttaatggatgccattggcctagggatatgaagcttagatctgatactaggagtgga
attaaggattctgttgtatcctcacagtgtaattctccaagcacaaggagttttagaaag
aagggcacacttcaaatggagaataactcatcttttgtggatgctcagagtgattcaatg
gaggatacaaataatgaacattcagcaacagatggttgtgatagttcaaggaaagaggaa
tgtgttgatgagagtatatgcaggcaagaagctcatggcaggtcctggaaagtgattgag
caagggcttctattgaaaggattagagatttttggaaagaacagttgtttaattgctcgg
aaccttctgggtgggatgaaaacatgcacagatgtttttcagtatatgaattacattgaa
aacagcagtgcatctggagctcttagtggtgttgattctcttgttaaaggatatatgaag
ggtaatgaattacggacaagatcaagatttgtgagaaggcgaggaagggtccgccgtttg
aagtacacctggaaaactgcaggctaccattttataaggaaaaggattacagaaaggaag
gatcagccttgtcgacaatacactccttgtggttgccagtctgcatgtgggaagcaatgt
ccatgtctcacaaatggtacctgctgtgagaaatactgtgggtgcccgaaaatgtgcaag
aatcgcttccgaggttgccattgcgcaaagagtcagtgtcgcagccggcagtgtccatgc
tttgctgctgacagggaatgtgatcctgatgtgtgtagaaactgctgggtagggtgcggt
gatggtacattgggagtccctaaccaaagaggtgataattatgaatgccggaacatgaaa
ctgctgcttaaacagcaacaaagggtcttacttgggagatctgatgtttctggctgggga
gctttcctcaagaatagtgttgggaagcacgagtatcttggcgagtacactggggagctt
atctcccataaagaagctgacaagcgtggaaagatatatgaccgtgagaattcatcgttc
cttttcaacttgaacaatgagtacgttcttgatgcctacagaatgggcgacaagctgaag
ttcgccaaccattcccctgatccaaactgctacgccaaggtcatcatggtagcaggcgat
cacagggtggggatcttcgccaaagagcggatcagcgcgggcgaggagctgttctacgac
taccgctacgagcccgaccgggccccggcgtgggctcgcaagcccgaggggcccggtgcc
aaggacgacgcccagccttccaccgggagagcaaagaagctcgcccactga

DBGET integrated database retrieval system