KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0676700-01Help
Entry
Os06t0676700-01   CDS       T02163                                 

Gene name
Os06g0676700
Definition
(RAP-DB) Similar to High pI alpha-glucosidase.
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00052  Galactose metabolism
dosa00500  Starch and sucrose metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Os06t0676700-01 (Os06g0676700)
   00500 Starch and sucrose metabolism
    Os06t0676700-01 (Os06g0676700)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Os06t0676700-01 (Os06g0676700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
RAP-DB: Os06t0676700-01
LinkDB All DBs
Position
chr06:join(28100928..28101163,28102253..28102905,28102993..28103223,28104161..28104801,28104878..28105777)
AA seq 886 aa AA seqDB search
MATRARPPLVLLLCLCLASCLSSAIGGVSAAGNGYRTTAFLVDEEGRRLRAELAAVAGAG
GGSTAAYGDDVQRLDVYASLETDSRLHVRIADADGPRWEVPQDVIPRPSPEFFLQTSRPG
RPVLSTATSDLTFAIHASSPFRFAVSRRSTGDVLFDTSPNLVFKDRYLELTSSLPPPGRA
SLYGLGEQTKRTFRLQRNDTFTLWNSDIAAGNVDLNLYGSHPFYMDVRSGGGGAAHGVLL
LNSNGMDVIYGGSYVTYKVIGGVLDFYFFAGPSPLAVVDQYTQLIGRPAPMPYWSFGFHQ
CRWGYKNVSDLEGVVAGYAKARIPLDVMWTDIDYMDAFKDFTLDPANFPADLLRPFVDRL
HRNGQKYVVIIDPGISVNATYGTFIRAIKEDIFLKWNGSNYLGVVWPGNVSFPDFLNPRA
AEFWAREIAAFRRTLPVDGLWIDMNEISNFVDPPPLNALDDPPYRIDNSGVRRPINNKTV
PASAVHYGGVAEYDAHNLFGFLEARATHDALLRDTGRRPFVLSRSTFVGSGRYTAHWTGD
NFATWDDLRYSINTMLSFGLFGIPMIGADICGFGGNTTEELCSRWIQLGAFYPFSRDHSA
IGTVRRELYLWESVARSARKALGLRYRLLPYLYTLMYEAHTTGAPIARPLFFSYPGDVAT
YGIDRQFLLGRGVLVSPVLEPGATTVTAYFPAGRWFSLYDFSLAVATKTGKRVTLPAPAD
TVNVHVAGGNILTLQQPALTSSRVRQSVVHLLVALAEDGTATGDLFLDDGESPEMVGARS
RWSQIKFSGATESGGSVVRVRSHVVHDSYAPSRTMVIAKVVLMGLRSPVPPKGFAVYANG
VQVNASTAVDGGGGGNPEKGALGVAHVGGLSLVVGQEFDLKVVMTY
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagagctcggccgccattggtgctattgctgtgtctctgcttggcttcttgc
ttgagctcggccattggtggcgtttcagctgccggcaatggctaccggaccacggcattc
ctggtggatgaggaagggaggcggctcagagccgagctcgccgcagtcgccggcgccggc
ggcgggtccacggcggcgtacggcgacgacgtgcagaggctagacgtgtatgccagcctg
gagacggacagccggctgcacgttcgcatcgccgacgccgacggcccgcgatgggaggtg
ccccaggacgtcatcccgcgcccctcgccggagttcttcctccagacgtcgcgtccgggc
cggcccgtcctctccacggcgacctccgacctcaccttcgccatccacgcctcctccccg
ttccgcttcgccgtctcccgccgctccactggcgacgtcctcttcgacacctcccccaac
ctcgtcttcaaggatcgctacctcgagctcacctcctcgctgccgccgcccggccgcgcg
tcgctgtacggcctcggcgagcagaccaagcgcacgttccggctccagcggaatgacacc
ttcacgctctggaactccgacatcgccgccggcaacgtcgacctcaacctctacggctcc
caccccttctacatggacgtccggtcaggcggcggcggcgcggcgcacggcgtgctcctc
cttaacagcaacggcatggacgtcatctatggtggatcgtacgtcacctacaaggtgatc
ggcggcgtgctggatttctacttcttcgccggcccgtcccctctcgccgtcgtcgaccag
tacacccagctcatcggccgccctgcccccatgccgtactggtcattcgggttccaccag
tgcaggtgggggtacaagaacgtgtctgacctggagggcgtggtcgccggctatgccaag
gcgaggatcccgctggacgtgatgtggacggacatcgactacatggacgccttcaaggac
ttcacgcttgatccggcgaacttcccggccgacctgctccggccgttcgtcgaccgcctc
caccgcaacggccagaagtacgtcgtcatcattgacccagggatcagtgtgaacgcgacg
tacgggacgttcatccgagcgatcaaggaggacatcttcttgaagtggaacgggagtaac
tacctcggtgtggtgtggccggggaacgtctccttcccggacttcctcaacccgcgcgcc
gccgagttctgggcgcgcgagatcgccgcgttccggcggaccctccccgtcgacgggctg
tggatcgacatgaacgagatctccaacttcgtcgacccgccgccgctcaacgcgctcgac
gacccgccgtaccgcatcgacaactccggcgtgcgccgccccatcaacaacaagacggtg
ccggcctccgccgtgcactacggcggcgtggccgagtacgacgcgcacaacctcttcggc
ttcctcgaggcgcgggccacgcacgacgcgctgctccgtgacaccggccgccgcccgttc
gtgctcagccgctccacgttcgtcggctccggcaggtacaccgcgcactggaccggcgac
aacttcgcgacgtgggacgacctccgctactccatcaacactatgcttagcttcggcctc
ttcggcatccccatgatcggtgccgacatctgcggcttcggcggaaacaccaccgaggag
ctctgcagccgatggattcagcttggcgcgttctacccgttctcgagggaccactcggcg
atcggcaccgtccggcgagagctgtacctgtgggaatcggtggcgaggtcggcgaggaag
gcgctcggcctgcgctaccggctgctcccctacttgtacacgctcatgtacgaggcgcac
accacgggcgcgcccatcgcgcggccgctcttcttctcctaccccggcgacgtcgcgacg
tacggcatcgacaggcagttcctgctcggccgcggcgtgctcgtgtcaccggtgctcgag
ccgggcgcgaccaccgtcaccgcctacttcccggcgggacggtggttcagcctctacgac
ttctccctcgccgtcgccacgaagaccggcaagcgcgtgacgctgcccgcgccggcggac
acggtgaacgtgcacgtcgccggcgggaacatcctgacgctgcagcagcccgcgctgacg
tcgtcgcgcgtgcgccagagcgtggtccacctcctggtcgccctcgccgaggacggcacg
gccaccggggatctcttcttggacgacggcgagtcgccggagatggtcggggcgcggagc
aggtggagccagatcaaattcagcggcgcgaccgagagcggcggcagcgtcgtcagagtg
aggtcgcacgtggtgcacgactcgtacgcgccgagccggacgatggtcatcgccaaggtg
gtgctcatggggcttcgatcgccggtgccgcccaaggggttcgccgtttatgccaacggc
gtccaggtgaacgcgagcacggcggtcgacggcggcggcggcgggaacccggagaaggga
gcgctgggcgtggcgcacgtcggcgggctgtcgctggtcgtcgggcaggagttcgatctc
aaggtcgttatgacctattaa

DBGET integrated database retrieval system