KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0421300-01Help
Entry
Os07t0421300-01   CDS       T02163                                 

Gene name
Os07g0421300
Definition
(RAP-DB) Similar to Alpha glucosidase-like protein.
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00052  Galactose metabolism
dosa00500  Starch and sucrose metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Os07t0421300-01 (Os07g0421300)
   00500 Starch and sucrose metabolism
    Os07t0421300-01 (Os07g0421300)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Os07t0421300-01 (Os07g0421300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 Gsf2
Motif
Other DBs
RAP-DB: Os07t0421300-01
LinkDB All DBs
Position
chr07:join(13534828..13535043,13538899..13538967,13539041..13539178,13539264..13539381,13539844..13539926,13540500..13540592,13541380..13541548,13541635..13541777,13541865..13541951,13542027..13542212,13544197..13544364,13544778..13544898,13545651..13545720,13545968..13546055,13546144..13546264,13546543..13546736,13546818..13546926,13547067..13547222,13547437..13547536,13547694..13547867,13548128..13548273,13548375..13548568)
AA seq 980 aa AA seqDB search
MAASGKEAMVWVRILEEGVFRFDASEAARAAAGPSLSFAVPRRREEPRAGGDRPAIVPVC
EVVGDVQRVVVELPSGTSFYGTGESSGPLERTGKLVITWNTDAWDYGPGTTSLYQSHPWV
LAVLPDGKALGVLADTTCRCEIDLRQESTMKFSASCTYPVILFGPFNTPSEVTTSLSHAI
GTVSMPPKWSLGYHQCRYSYDSSEKVLQVVKTFRERGIPCDVVWMDIDYMDGFRCFTFSH
RFPDPKCMVDDLHSVGCKAIWMLDPGIKNESGYFVFDSGLESDVWVQKEDKQPFVGEVWP
GDCVFPDFTCERARSWWSGLVRQFVSNSVDGLWNDMNEPAVFNTATKTMPESNIHRGDAN
IGGLQNHPYYHNVYGMLMAKSTYEGMKLANPTKRPFVLTRAGFIGQQRYAAMWTGDNVSN
WEHLHMSIAMVLQLGLSGQPFAGPDIGGFAGNATPKLFGRWMGVGALFPFSRGHSDKGSL
DHEPWSFGEECEEVCRLALLRRYRLLPHIYTLFYLSHTNGTPVAAPVYFADPQDLELRKI
ETSFLLGSLLVCASTCPDKGAHESSQKLPKGIWLPFDFGDSHPDLPMMYLRGGAVLPIGL
PLNHVGEAKLDDNLSLIIALDENGKAEGVLFEDDGDGYEFLQGNYLLTYYVAELHSSVVT
VKVARTEGSWKRPNRNLKINILLGGGAMVSTHGIDGEDLHLTMPTESEVSSLVATSELEL
KKRFEMVRPIPDIDKPLGKEVAELSEIPIDLNGEDWLVKVVPQIGGRIISMTHLPSDSQW
LHSTNRINGYEEYNAAEDTAGCTEEYKVIRRYREQSGKEESICLEGDIGGGLVLQRQISI
CKENPKIVKIDSSIRAKQGADHSGGFSGLACLRVRPSFILQYPTEVSVVFTASNGIKREI
LPDSGELTFEGVLRPNGEWMLVDKRTNLSLVNCFDLSQVSICKLHWGTDHLNMELWSEQR
AVSKDTPLRICHHYEVRKIN
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcggggaaggaagcgatggtgtgggtgcggatactggaggagggggtgttc
cggttcgacgcgtcggaggccgcgcgggcggcggcggggcccagcctctcgttcgccgtg
ccgcggcggcgagaggagccgcgcgccggaggggaccgcccggcgatcgtgccggtgtgc
gaggtggtgggagatgtccagcgcgtcgtggttgagcttccttctgggacatctttctat
ggtactggagaatcaagtgggccacttgagagaactggaaagctggttattacttggaac
acggatgcatgggattatggtccaggaaccacatcactatatcagtcacacccttgggta
ctggctgttcttcctgatgggaaggcattgggagtccttgctgacactacttgccgctgt
gagattgacttacggcaagaatctactatgaaattttctgcttcatgcacttaccctgtc
atactgtttggaccttttaatacaccctctgaagttaccacatccttgtctcatgcaatt
ggaactgtgtccatgccaccaaaatggtcactcggataccatcaatgtcgttatagctat
gactcttctgagaaagtactgcaggttgttaaaacatttagagaaagaggcattccttgt
gatgttgtatggatggatattgattacatggatggttttaggtgctttacgtttagccat
cgtttccctgatccgaaatgtatggttgatgatctccattcggttggctgcaaagcaata
tggatgcttgacccaggaatcaagaatgagagcggttactttgtgtttgatagcggttta
gaaagtgatgtttgggttcaaaaggaagacaagcagccgttcgttggagaagtatggcct
ggtgattgtgttttccctgattttacttgtgaaagagcccgctcctggtggtctggctta
gtaaggcagttcgtctctaatagcgttgatggattatggaatgatatgaatgaacctgct
gtttttaatactgccaccaaaacaatgccagaaagcaatatccatagaggagatgctaat
attggtggtctccagaatcatccgtactaccataacgtctatggaatgctcatggcaaaa
tctacttatgagggaatgaaattggccaatccaactaaacggccatttgttcttactcga
gctggttttataggacaacaacgctatgctgctatgtggactggtgataatgtatcaaac
tgggaacatctccacatgagtatagccatggttcttcagttgggtcttagtggtcaacca
tttgcaggcccagatattggtgggtttgctgggaatgctactccaaaactttttggaaga
tggatgggagtgggtgcattgtttccattttctcgtggccattctgataaaggaagcttg
gaccatgagccgtggtcctttggggaagagtgtgaggaggtttgtcgccttgctttacta
agacggtaccggctattaccacacatttatactctattttacctttctcatacgaacgga
actcctgttgctgctccagtttacttcgcagatccacaagatttagagttaaggaaaatt
gagacctcatttctcttgggatcacttctagtttgtgcaagcacttgtcctgataaagga
gctcatgaatcttcacagaagctgccaaagggaatttggttgccttttgattttggagat
tcacaccctgatctgccgatgatgtatttacgaggtggagcagtacttcccataggcctt
cctctcaatcatgttggtgaagcaaaattggatgataatttgtcattgattattgcatta
gatgaaaatggaaaagctgaaggtgtcctctttgaagatgatggggatggatatgagttc
cttcaagggaattatcttttgacatactatgttgcagaactccactcatcagtggttact
gttaaagttgcccgaactgaaggatcatggaagagaccaaatcgcaacttaaaaataaat
atattgcttggaggaggtgctatggtaagtacgcacggcattgatggggaagatttacat
ctaacaatgcctactgaatctgaagtgtcaagtctagtggcaacaagtgaacttgagctc
aaaaaacgttttgagatggttcgacctattccagacatagataagccattagggaaggaa
gtggctgaactttctgaaatacctattgatttgaacggcgaggactggttggttaaagtt
gtaccccagatcggtggtcgtattatctcaatgacacatcttccatctgattctcaatgg
ctacacagcacaaataggatcaatgggtatgaggaatataatgcggctgaagatactgct
ggctgcacagaagagtacaaagtcattaggaggtatcgcgagcaatcaggaaaagaggaa
tctatttgtttggaaggagatattgggggtggtttggttcttcagcgccaaatatccatt
tgtaaggaaaacccaaagattgttaagatcgactccagtattcgagcaaaacagggagct
gatcattctggtgggttttcagggttggcctgtttgagggttcgtcctagtttcattctt
cagtaccctacagaggtttctgttgtgtttacagcaagcaacggtataaagcgagaaata
cttccagattctggagaattgacatttgagggagttcttcgtcccaatggggaatggatg
ctagttgacaaacgtacgaatctgagcctggtaaattgcttcgatctcagtcaggttagt
atatgtaagttgcattggggaactgatcatttgaacatggaactgtggtcggagcaaaga
gcagtttctaaggacacaccgttaagaatttgccaccattatgaggtgagaaaaataaac
taa

DBGET integrated database retrieval system