KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0602200-01Help
Entry
Os07t0602200-01   CDS       T02163                                 

Gene name
Os07g0602200
Definition
(RAP-DB) Similar to HDA1.
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:dosa01009]
    Os07t0602200-01 (Os07g0602200)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:dosa03019]
    Os07t0602200-01 (Os07g0602200)
   04131 Membrane trafficking [BR:dosa04131]
    Os07t0602200-01 (Os07g0602200)
   03036 Chromosome and associated proteins [BR:dosa03036]
    Os07t0602200-01 (Os07g0602200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Os07t0602200-01 (Os07g0602200)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Os07t0602200-01 (Os07g0602200)
Messenger RNA biogenesis [BR:dosa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Os07t0602200-01 (Os07g0602200)
Membrane trafficking [BR:dosa04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Os07t0602200-01 (Os07g0602200)
Chromosome and associated proteins [BR:dosa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Os07t0602200-01 (Os07g0602200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
RAP-DB: Os07t0602200-01
LinkDB All DBs
Position
chr07:join(24592102..24592262,24592809..24593010,24593109..24593255,24593412..24593524,24594160..24594371,24594774..24594838,24595161..24595331,24595418..24595507,24596123..24596467,24596560..24596753,24596872..24597028,24597526..24597590,24597746..24597911)
AA seq 695 aa AA seqDB search
MAAATTAAAAARVGLLYDERMCAHATPDGEEHPENPERLRAIWRKLSADGVASRCMIMKA
KEAEDKYIASVHSQNHIKLMRSISSKEYDSRRNKIARKFNSIYFNKGSSESAFLAAGSVI
EVAEKVAAGELSSAIALVRPPGHHAEHNEAMGFCLFNNVAIAADYLLNERTDLGIKKILI
VDWDVHHGNGTQKMFYSDPRVLFFSVHRFDYGSFYPAEGDASYCFIGEGDGKGYNINVPW
EHGKCGDADYIAAWDHVLLPVAEAFNPDIVLVSAGFDAALGDPLGGCCITPNGYALLLTK
LLGFAQGRIVMALEGGYNLRSIANSVSACAKVLLGDKFRFDTPDMQPFESSWRVIQAVRD
ELKTFWPVLSNRLPENISLRSRPSQIELYSSGSDSEVEDLPDAIASVNIIQITYGIISES
LSKLNLDEDKIATKTTSSNVMVEGPTDSVEPQNDGSAAVSTEGISSLSSTWRSELSKVYV
WYASFGSNMWTPRFLCYIQGGKAEGMNIPCFGSHDTSPPRGSMWKTVPHRLFFGRSSTPC
WGTGGVAFLNPEINHTENSYVCMYKITLEQFNDVLFQENRLVKENGESGKTESPDSPLIG
LSEIEFVSRNKGVHLAPIKDSWYSNVLYLGEEDNLPILTMTCPSSDVERCRSGELPLCPP
SKTYSATLIRGLMEGKHLDADAAASYINTAATRGL
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgacgaccgccgcggcggcggcgagggtggggctgctgtacgacgagagg
atgtgcgcgcacgcgacgcccgacggggaggagcacccggagaaccccgagaggctgcgg
gccatctggcgcaagctctccgccgacggcgtcgcctccaggtgcatgatcatgaaagcg
aaggaagctgaggacaagtatatagcttctgtccatagccagaaccatatcaagctgatg
aggagtatcagctcaaaagaatatgattcccgtcgaaacaagattgctagaaaatttaat
tccatttacttcaacaagggctcctcagagtctgcttttcttgcagctggttctgtgatt
gaggtagctgagaaggttgctgcaggagagttaagttctgctattgctctagtccgacct
ccaggtcaccatgctgaacataatgaggcaatgggtttttgcctcttcaacaatgtagca
attgctgctgattatctcttaaatgagaggactgacttaggtatcaagaagatattgatt
gtcgattgggatgttcatcatggaaatggcacacaaaagatgttttatagtgatcctcgt
gtattgttcttttcagttcacagatttgattatggcagcttctatcctgctgaaggggat
gcatcttactgtttcattggggaaggagatggtaaagggtacaacattaacgtgccctgg
gaacatggaaaatgtggtgatgcagattatattgctgcatgggaccatgtactacttcct
gttgctgaagcatttaaccctgatatagtcttggtgtctgctgggtttgatgcagcactg
ggtgatcctcttggtggctgctgcatcactcccaatggatatgctctgctactgacaaag
ctcttaggttttgcccaagggaggatagtgatggctcttgaaggaggctataaccttaga
tccatagcaaattcagttagtgcttgtgctaaagttttgttgggagacaagttcagattt
gacactcctgatatgcaaccgtttgaatcttcatggagagttatacaagcggtacgtgat
gaattgaagacgttctggcctgttctgagtaatagattgccagagaatatatcattgagg
agtaggccctcacaaattgagctgtattcttctggttctgactctgaagttgaagatctc
cctgatgctattgcttctgtcaatattattcaaattacttatggtattataagtgaaagc
ctctcaaagttgaaccttgatgaagacaaaatcgcaacaaagaccacctcaagtaatgta
atggttgaaggtccaactgattcagttgaaccacaaaatgatggatctgctgcggtgtca
actgaaggaatatcatctctatcttctacttggagatcagaactgtcaaaagtatatgtt
tggtatgccagctttggttcaaacatgtggacaccaaggtttctgtgctacatccaaggg
ggaaaggctgagggtatgaatataccatgttttggatctcatgacacaagcccaccaaga
ggttccatgtggaagactgtgcctcatagattgttttttggtagatcctctactccttgc
tggggaactggtggtgttgcttttctcaaccctgagataaaccacactgagaactcctat
gtctgcatgtataaaataacgctcgagcagttcaatgatgtattgtttcaagagaatcgt
ttagtgaaggagaacggcgaaagtggaaaaactgagtctcctgactctcctttgattggc
ttgtctgaaatagagtttgtttccagaaacaagggtgtccaccttgcacctattaaggat
agctggtactccaatgtactttaccttggggaggaggataaccttccaattcttacaatg
acatgcccgtcatcagacgtagagcgatgcagatccggagagctgccattgtgtcctcca
tccaagacctactccgccaccctgataaggggactaatggaagggaagcacctggatgca
gatgcggccgctagttacatcaacactgcagctaccagaggcctgtga

DBGET integrated database retrieval system