KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0366000-01Help
Entry
Os08t0366000-01   CDS       T02163                                 

Gene name
Os08g0366000
Definition
(RAP-DB) Phosphoenolpyruvate carboxylase.
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00620  Pyruvate metabolism
dosa00710  Carbon fixation in photosynthetic organisms
dosa01100  Metabolic pathways
dosa01200  Carbon metabolism
Module
dosa_M00168  CAM (Crassulacean acid metabolism), dark
dosa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
dosa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
dosa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Os08t0366000-01 (Os08g0366000)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os08t0366000-01 (Os08g0366000)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Os08t0366000-01 (Os08g0366000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
RAP-DB: Os08t0366000-01
LinkDB All DBs
Position
chr08:complement(join(16970083..16970247,16968248..16968639,16968081..16968165,16967666..16967888,16967483..16967586,16967324..16967411,16967082..16967236,16965979..16966977,16965457..16965843,16965035..16965331))
AA seq 964 aa AA seqDB search
MAGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLRELVQECY
EIAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKL
KKGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSL
LQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMS
YFHETIWKGVPKFLRRLDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMASNLYCSQIEDLMFELSMWRCNDELRARADELHLSSKKDAKHYIEFWKKVPP
SEPYRVVLGDVRDKLYNTRERARQLLSSGYSDIPEETTLTSVEQFLEPLELCYRSLCDCG
DRVIADGTLLDFLRQVSTFGLCLVRLDIRQESDRHTDVLDAITTYLGIGSYREWSEERRQ
DWLLSELNGKRPLFGPDLPKTDEIADVLDTFRVIAELPADNFGAYIISMATAPSDVLAVE
LLQRECHVKTPLRVVPLFEKLADLESAPAAVARLFSIDWYRERINGKQEVMIGYSDSGKD
AGRLSAAWQLYKSQEELINVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPIAPKPEWRALLDEMAVVATKE
YRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGSAFKHILEKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDKL
LVSEELWPLGEKLRANCEETKQLLLQVAGHKDLLEGDLYLKQRLRLRNAYITTLNVCQAY
TMKRIRDPDYHVTLRPHMSKEIMDWSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaaggtggagaagatggcgtcgatcgacgcgcagctgcggatgctggcgccg
gcgaagctgtcggaggacgacaagctggtggagtacgacgccctcctcctcgaccgcttc
ctcgacatcctccaggacctccacggcgacgacctccgcgagctggtccaagaatgctat
gagatcgctgctgagtatgaagggaagcatgactcccaaaagctcgatgaacttggcaac
atgttgacaagcttggatcctggtgactccattgtgatggccaaagctttctcccacatg
cttaatttggctaacttggccgaggaggtccagattgcatacaggaggagaatcaagctc
aagaagggtgactttgctgatgagaactcggcactgacagaatctgacattgaagaaact
tttaagaggcttgttgttgacctgaagaaatcaccagcagaggtctttgatgcccttaag
agtcagactgttgacctggttttgactgcacatccaacacagtcagtgaggaggtcactg
cttcaaaaacactcaaggataaggaattgtttggttcaactatactcaaaggatatcaca
ccagatgataaacaggagcttgatgaggctctccagagggagattcaagcagcctttaga
actgatgagatccgaagaacccagccaactcctcaagatgaaatgagggctggtatgagt
tactttcatgagacaatctggaaaggtgttccgaagttcttacgccgtctggacactgcc
ttgaagaacatcggaattgatgagcgtgttccttataatgcacctctcattcagttctct
tcttggatgggaggagaccgtgatggaaatccaagagtgacaccagaagtcacaagggat
gtatgcttgcttgctagaatgatggcttcaaatttatactgctcgcaaattgaggatctc
atgtttgagctgtctatgtggcgatgcaatgatgagcttcgggcacgagcagatgagctg
catctctcctcaaagaaagatgcaaagcactatatagaattctggaagaaggttccgccc
agtgagccataccgagttgttctaggtgatgtgagagacaagctgtacaacacacgtgaa
cgagcacgccagttattatccagcggatattctgacattcctgaagaaaccactctcacc
agtgttgaacagttcttagagcctctggagctatgttacaggtcactctgcgattgcggt
gaccgtgtaattgctgatgggacccttctggacttcttgcgccaggtgtctacctttggg
ctgtgccttgtgaggcttgacattaggcaagaatctgacaggcacaccgatgtcctcgat
gccatcaccacatacctgggaataggatcataccgtgagtggtccgaggaacgccgtcag
gactggctcttgtctgaactcaatgggaagcgcccattgtttggcccagaccttcccaag
accgatgagattgctgacgttctagacacgttccgcgtgatagctgagcttcccgctgac
aattttggggcctatatcatttccatggcgacagctccgtcagacgtgcttgctgttgag
ctcctccaacgtgaatgccatgtgaagacaccacttagagttgtcccactgtttgagaag
ttggctgatcttgaatctgccccagcagcagtggccagactgttctccatagattggtac
agagaaaggataaatggcaaacaggaggtcatgattggctattcggactcgggtaaggac
gccggtcgtctctcggcagcttggcagctgtacaagtctcaggaggagctcatcaacgtt
gccaaggagtttggggtgaagttgacaatgttccatgggcgcggtgggactgtcggaaga
ggcggaggtcccactcatcttgccatcttgtctcagccaccagacacaatccatggatct
ctccgggtcactgtccagggtgaagtcattgagcagtcctttggtgaggagcacctttgc
ttcaggacactgcagcgtttcacggctgccactctggagcatggcatgcatccaccaatt
gcgccgaaaccagaatggcgtgctctgcttgatgagatggctgtggtggctacaaaggaa
taccggtccatcgtcttccaggaaccacgctttgtcgagtatttccgccttgcaacacca
gagatggagtatggaaggatgaatataggaagcaggccatccaagagaaagccgagtggt
ggcatcgagtcactccgtgccatcccatggatcttcgcgtggacgcaaactcgcttccac
cttcctgtctggcttggcttcggttctgccttcaagcacatcctggagaaggacatcagg
aacctccacatgctccaggagatgtacaatgagtggccgttcttcagagtcacgatcgat
ctggttgagatggttttcgccaagggtgaccctggcatcgccgcattgtacgacaagctc
cttgtctccgaggagctatggcctctgggagagaaactgagggccaactgtgaagaaacc
aaacagcttctccttcaggttgctggacacaaggatcttctcgaaggtgatctctacctg
aagcagcgccttcgcctccgcaatgcctacatcaccaccctgaatgtctgccaggcttac
acgatgaagcgaatccgcgacccggactaccatgtcacgctgcgcccccacatgtccaag
gagatcatggactggtctaagccggctgcggagctggtgaagctgaacccgaccagtgag
tatgcgccggggctggaggacaccctcatcctgaccatgaagggaattgctgctggaatg
cagaacaccggctaa

DBGET integrated database retrieval system