KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0431300-01Help
Entry
Os08t0431300-01   CDS       T02163                                 

Gene name
Os08g0431300
Definition
(RAP-DB) Similar to Dihydrolipoamide S-acetyltransferase.
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa00020  Citrate cycle (TCA cycle)
dosa00620  Pyruvate metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
Module
dosa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os08t0431300-01 (Os08g0431300)
   00020 Citrate cycle (TCA cycle)
    Os08t0431300-01 (Os08g0431300)
   00620 Pyruvate metabolism
    Os08t0431300-01 (Os08g0431300)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Os08t0431300-01 (Os08g0431300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PASTA
Motif
Other DBs
RAP-DB: Os08t0431300-01
LinkDB All DBs
Position
chr08:complement(join(20861285..20862172,20860986..20861177,20860809..20860896,20860652..20860722,20860472..20860555,20859069..20859173))
AA seq 475 aa AA seqDB search
MATTPAPVSLSAAASTVPARLLVGRGAAAAPVARRRARMVVVRAKIREIFMPALSSTMTE
GKIVSWSAAEGDRVAKGDAVVVVESDKADMDVETFHDGIVAAVLVPAGESAPVGAPIALL
AESEDDLQAALAKAQELSKAHPQQAPPPSDAAAPPPPPPPPAAAPAAPAPVAAGTKGIAT
PQAKKLAKQHRVDLAKVAGTGPFGRITPADVEAAAGIEPKPKVVPAASAAPVPLSAPAIG
AVPQAAELPPVPGATVVPFTGMQAAVSKNMVESLAVPAFRVGYPIVTDKLDELYEKVKSK
GVTMTVLLAKAAAMALAQHPVVNASCRDGKSFTYNTNINIAVAVAIDGGLITPVLEDADK
LDIYLLSQKWKELVKKARAKQLQPNEYSSGTFTLSNLGMFGVDRFDAILPPGQGGIMAVG
ASKPTVVADKDGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFAKIIEDPESLTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgactccagcgcccgtctcgctctcggccgcggcctccaccgtgccggcgcgc
ctcctcgtggggcggggcgccgcggcggcgccggtggcgaggcggcgggcgaggatggtg
gtggtgcgggccaagatccgggagatcttcatgccggcgctgagctccaccatgacggaa
gggaagatcgtgtcgtggtcggccgccgagggggaccgcgtcgccaagggggacgccgtg
gtggtcgtcgagtccgacaaggccgacatggacgtcgagacgttccacgacggcatcgtc
gccgccgtcctcgtccccgccggtgagtccgcccccgtcggcgcccccatcgcgctgctc
gccgagtccgaggacgacctccaggccgccctcgccaaggcccaggagctctccaaggcc
cacccgcagcaggcgcctccaccctccgatgccgccgcgccgccaccgccgcctcctcca
cccgcggccgctccggcggctccggcgccggtggcagccggcacgaagggcattgccacc
ccgcaagctaagaagctggccaagcagcatagggtggacctagctaaggtggctggcact
gggccgttcgggcgaattacgccggccgatgttgaggctgccgccggcatcgagccgaag
ccgaaggttgtgcctgctgcttctgctgctcccgtgccgctgtctgctccggcaattggc
gccgtgccacaggccgcggagcttcctccggtgcccggtgccacggtggttccattcact
ggcatgcaggctgcagtgagcaagaacatggtggagagcctcgcggtgcccgcattccgt
gtgggatacccaattgtgaccgataagctcgatgagctatatgagaaggtcaagtcaaag
ggggtgaccatgacagttctgctggcgaaggccgcagctatggcacttgcgcagcacccg
gtggtgaatgctagctgcagggatgggaagagcttcacttacaacaccaacatcaacatc
gcggtggctgtcgcaatcgatggtgggctcattacacctgttctggaggatgctgataag
ttggatatatatttgctctcacaaaaatggaaggaactagtcaagaaagctcgtgcaaaa
cagctccaaccaaatgagtacagctctgggacatttacactgtcaaacttgggtatgttt
ggtgttgatagatttgatgcaattcttccacctggccagggaggcataatggctgtcgga
gcctcaaaacctacagtggtggctgataaagatggtttctttagtgtcaagagcaaaatg
ctggttaatgtcactgctgatcacagaattgtatacggtgctgatctggcagcattcctg
caaacttttgcaaagattattgaggatcctgagagcttaactttgtaa

DBGET integrated database retrieval system