KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0439000-01Help
Entry
Os08t0439000-01   CDS       T02163                                 

Gene name
Os08g0439000
Definition
(RAP-DB) Similar to pyrophosphate--fructose 6-phosphate 1-phosphotransferase.
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa00030  Pentose phosphate pathway
dosa00051  Fructose and mannose metabolism
dosa00052  Galactose metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
dosa01230  Biosynthesis of amino acids
dosa03018  RNA degradation
Module
dosa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os08t0439000-01 (Os08g0439000)
   00030 Pentose phosphate pathway
    Os08t0439000-01 (Os08g0439000)
   00051 Fructose and mannose metabolism
    Os08t0439000-01 (Os08g0439000)
   00052 Galactose metabolism
    Os08t0439000-01 (Os08g0439000)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Os08t0439000-01 (Os08g0439000)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dosa01009]
    Os08t0439000-01 (Os08g0439000)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dosa03019]
    Os08t0439000-01 (Os08g0439000)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Os08t0439000-01 (Os08g0439000)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Os08t0439000-01 (Os08g0439000)
Messenger RNA biogenesis [BR:dosa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Os08t0439000-01 (Os08g0439000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
RAP-DB: Os08t0439000-01
LinkDB All DBs
Position
chr08:complement(join(21328442..21328824,21328257..21328338,21327883..21327956,21327581..21327692,21326938..21327033,21326779..21326862))
AA seq 276 aa AA seqDB search
MHNLLNIFSRLLDDNHFELVHILIKMAVSLKSSGSFCSTPPQWLHSTRDRILYGYSHSNA
KECTCKKTKRPAPLCVKATSTKVELDFNDPSWKQKFQEDWDKRFNLPRITDIYDLKPRPT
TFSLKKNRSPAGDENGTPMDKWNGYVNSDDRALLKVIKYSSPNSAGAECIDPDCSWVEQW
VHRAGPRKEIYYEPEEVKAAIVTCGGLCPGLNDVIRQIVFTLETYGVKNIVGIPFGYRGF
FEKGLKEMPHHPAFTSSGGEHKSCWWKFSRSLSWRS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcacaatttgctgaatatcttttccagactgttggacgataaccactttgagctggtg
cacatccttatcaagatggctgtttctttaaaatcaagtggcagtttttgtagcacaccg
cctcagtggctgcattcaacaagggatcgaattttatacggttattctcattcaaatgcc
aaagagtgcacttgcaagaaaacaaaaaggcctgctccactgtgtgttaaagctacttcc
acgaaagtggaattagatttcaatgatccatcttggaagcagaagtttcaggaagactgg
gataaacgttttaatttgccacgtattacagacatatatgatttgaaaccaaggccaacc
acattctcactcaagaaaaacagaagtcctgcaggtgatgaaaatggtacacctatggat
aaatggaatggttatgtgaacagcgatgatcgagcacttttgaaggtgataaagtattcc
tcgcctaactctgctggagcagagtgcattgatcctgactgtagctgggtggaacaatgg
gtacatcgtgcaggccctcgtaaggagatatactatgaaccagaggaagtaaaagctgcc
atagttacttgtggagggctctgccctggtttgaacgatgtcatcagacagatagtattc
actctagagacctatggggttaagaatattgttgggattccatttggttatcgtggattt
tttgaaaagggcctaaaagaaatgccacatcatccagctttcacgtcatctggtggagaa
cataaatcttgctggtggaagttttctaggagtctctcgtggaggagctaa

DBGET integrated database retrieval system