KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0465800-01Help
Entry
Os08t0465800-01   CDS       T02163                                 

Gene name
Os08g0465800
Definition
(RAP-DB) Similar to Glutamate decarboxylase.
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00250  Alanine, aspartate and glutamate metabolism
dosa00410  beta-Alanine metabolism
dosa00430  Taurine and hypotaurine metabolism
dosa00650  Butanoate metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Os08t0465800-01 (Os08g0465800)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Os08t0465800-01 (Os08g0465800)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Os08t0465800-01 (Os08g0465800)
   00430 Taurine and hypotaurine metabolism
    Os08t0465800-01 (Os08g0465800)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Os08t0465800-01 (Os08g0465800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
RAP-DB: Os08t0465800-01
LinkDB All DBs
Position
chr08:complement(join(22882423..22882508,22882117..22882321,22880708..22880908,22880401..22880615,22879852..22880105,22879715..22879767,22878994..22879473))
AA seq 497 aa AA seqDB search
MVLSHASSGRDDAVRCTFATRYACETLPRFRMPEQSIPREAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIKEDETAIG
VGTVGSSEAIMLAGLAFKRKWQNKRKEQGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNNLLTEKNKETGWDVP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYPGVGWVIWRSKEDLPEEL
IFHINYLGTDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMQNCMENTAILREGIEA
TGRFEILSKEAGVPLVAFSLKDSGRYTVFDISEHLRRFGWIVPAYTMPANAEHVAVLRVV
IREDFSRSLAERLVSDIVKILHELDAHSAQVLKISSAIAKQQSGDDGVVTKKSVLETERE
IFAYWRDQVKKKQTGIC
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcgcacgcgagctccggccgggacgacgccgtgcgctgcaccttcgcgacg
cgctacgcctgcgagacgctgccgcggttcaggatgccggagcagtcgatcccgagggag
gcggcgtaccagatcatcaacgacgagctgatgctggacgggaacccgcggctgaacctg
gcgtccttcgtcaccacgtggatggagcccgagtgcgacaagctcatcatggactccgtt
aacaagaactacgtcgacatggacgagtaccctgtcaccacggagctccagaaccgttgt
gtgaatatgatagctcacctgttcaatgcaccaatcaaggaggatgaaacagctattgga
gttgggacggtgggatcctcagaagcaattatgcttgcaggactggcattcaagaggaag
tggcaaaacaaacggaaggaacaggggaagccatgtgacaaacccaacattgttactggt
gctaatgttcaggtttgctgggagaaatttgccagatattttgaagtagaactgaaggag
gttaagctcagtgaaggatactatgtcatggatcctgtaaaggctgttgaaatggtggat
gagaacactatatgcgttgcggccatcttgggctctactctcactggagagtttgaggat
gttaagttattgaataatctcctaacagaaaagaataaggaaactgggtgggatgtgcca
attcatgttgatgcagcaagtggaggatttatagcaccttttctataccctgagcttgaa
tgggacttcaggctaccactggtgaagagcatcaatgtcagtgggcacaagtatggcctt
gtgtatccaggtgttggttgggtcatttggcgaagcaaagaggatttgcctgaagaactc
attttccatataaactatctggggacagaccagccgacgttcactctgaacttctccaaa
ggttccagccagataatcgcacagtactatcaactaatacgcctgggattcgagggatac
aagaacatcatgcagaattgcatggagaacacagcaatactaagggaaggcatagaggcg
actggtcgattcgaaatcctctccaaggaggccggtgtgcccttggtggcgttctcgctc
aaggacagcggcaggtacaccgtgttcgacatctccgagcacctgaggaggttcggctgg
atcgtgccggcgtacaccatgccggccaacgccgagcacgtcgccgtcctccgcgtcgtc
atcagggaggacttcagccggagcctcgccgagcggctcgtctcggacatcgtcaagatc
ctgcacgagctggacgcccattcggcccaggtgctgaagatctccagcgccatcgcgaag
cagcaatcgggcgacgatggcgtggtcaccaagaagagcgtcctggagaccgagagggag
atcttcgcgtactggagggaccaggtgaagaagaagcagaccggaatctgctag

DBGET integrated database retrieval system