KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0561700-01Help
Entry
Os08t0561700-01   CDS       T02163                                 

Gene name
Os08g0561700
Definition
(RAP-DB) Similar to Superoxide dismutase.
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Os08t0561700-01 (Os08g0561700)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Os08t0561700-01 (Os08g0561700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
RAP-DB: Os08t0561700-01
LinkDB All DBs
Position
chr08:join(28132549..28132798,28133228..28133289,28133402..28133441,28134176..28134271,28134380..28134411,28134516..28134591,28134672..28134725,28135158..28135183)
AA seq 211 aa AA seqDB search
MQAILAAAMAAQTLLFSATAPPASLFQSPSSARPFHSLRLAAGPAGAAAARALVVADATK
KAVAVLKGTSQVEGVVTLTQDDQGPTTVNVRVTGLTPGLHGFHLHEFGDTTNGCISTGPH
FNPNNLTHGAPEDEVRHAGDLGNIVANAEGVAEATIVDKQIPLSGPNSVVGRAFVVHELE
DDLGKGGHELSLSTGNAGGRLACGVVGLTPL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccatcctcgccgctgccatggccgcccagaccctcttgttctccgccaccgcc
cctcccgcctcccttttccagtccccttcctctgcccgccctttccactcgctccgcctc
gccgccggccccgcgggcgccgccgctgccagggcgctcgtcgtcgccgacgccaccaag
aaggccgtcgccgtgctcaagggcacctcccaggttgagggagtcgtcaccctcacccag
gatgaccaaggtcctacaacagtgaatgtccgtgtgacgggacttactcctggacttcac
ggcttccacctccacgagtttggcgatactacgaatgggtgcatatcaacaggaccacat
tttaacccaaacaatttgacgcacggtgcaccagaagatgaagtccgtcatgcgggtgac
ctgggaaacattgttgccaatgctgaaggtgtagctgaggcaaccattgttgataagcag
attcctctgagtggcccaaattctgttgttgggagagcattcgttgttcatgagcttgaa
gatgatttggggaagggtggccatgagcttagtctcagtactggaaatgctggtgggcga
cttgcatgcggtgttgttgggctgaccccgttgtag

DBGET integrated database retrieval system