KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0370300-01Help
Entry
Os09t0370300-01   CDS       T02163                                 

Gene name
Os09g0370300
Definition
(RAP-DB) Similar to Iron sulfur subunit of succinate dehydrogenase (Truncated) and ribosomal protein S14 precursor.
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00020  Citrate cycle (TCA cycle)
dosa00190  Oxidative phosphorylation
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Os09t0370300-01 (Os09g0370300)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Os09t0370300-01 (Os09g0370300)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Os09t0370300-01 (Os09g0370300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_16
Motif
Other DBs
RAP-DB: Os09t0370300-01
LinkDB All DBs
Position
chr09:complement(12295771..12296706)
AA seq 311 aa AA seqDB search
MILRRTLPRLASAKDGSGGGFADGHFPSLRGHPAARANARDAAEKQAALAAKEEEIRDHR
RGDAAAASPAPSTVKEFRVYRWSPDAPSRRPHLQSYHVDLATCGPMVLDVLQKIKAEHDA
TLAFRRSCREGICGSCSMCIDGVNTVACLRPVDTDTSSATTVTPLPHMYVVRDLVVDLTS
FYQQYKSVEPWLKRKTKTKTETTEHAQSPEERKRLDGLYECILCACCSAACPSYWWNAEA
FLGPAALLHAYRWVSDSRDEYAAERVQALAEGWDKLYRCRMIKSCTATCPKSLDPAAAIS
AMKTLHQLGKP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgattctgcggaggacgctgccgaggctggcctcggcgaaggacggcagcggcggcggc
ttcgccgacggccacttcccctccctccgcggccaccccgccgcgcgcgccaacgcgcgg
gacgccgccgagaagcaggcggcgctggctgcgaaggaggaggagatcagggaccaccgg
cgcggcgacgccgcggcggcgtcgccggcgccgtcgacggtgaaggagttccgggtgtac
cggtggagcccggacgccccctcgcggcggccgcacctgcagtcgtaccacgtcgacctc
gccacatgcggtcccatggtgctggacgtcctgcagaagatcaaggcggagcacgacgcg
acgctggcgttccggcggtcgtgccgggagggcatctgcgggtcgtgctccatgtgcatc
gacggggtgaacaccgtggcgtgcctcaggcccgtggacaccgacacctcgtcggccacg
acggtgacgccgctgccccacatgtacgtcgtgagggacctcgtcgtcgacctgaccagc
ttctaccagcagtacaagtcggtggagccgtggctgaagaggaagacgaagacgaagacg
gagacgacggagcacgcgcagtcgccggaggagaggaagaggctggacgggctgtacgag
tgcattctgtgcgcgtgctgcagcgcggcgtgcccgtcctactggtggaacgcggaggcg
ttcctggggccggcggcgctgctgcacgcgtaccggtgggtgtcggacagccgcgacgag
tacgcggcggagcgggtgcaggcgctggcggaggggtgggacaagctctaccgctgccgg
atgatcaagagctgcacggccacctgccccaagagcctcgaccccgccgccgccatctcc
gccatgaagaccctgcaccagctcggcaagccatga

DBGET integrated database retrieval system