KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0467200-01Help
Entry
Os09t0467200-01   CDS       T02163                                 

Gene name
Os09g0467200, TAU_GLUTATHIONE_S-TRANSFERASE_17, GSTU17
Definition
(RAP-DB) Similar to Glutathione S-transferase GST 23 (EC 2.5.1.18) (Fragment).
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Os09t0467200-01 (Os09g0467200)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dosa02000]
    Os09t0467200-01 (Os09g0467200)
Enzymes [BR:dosa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Os09t0467200-01 (Os09g0467200)
Transporters [BR:dosa02000]
 Other Transporters
  Pores ion channels [TC:1]
   Os09t0467200-01 (Os09g0467200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_6
Motif
Other DBs
RAP-DB: Os09t0467200-01
LinkDB All DBs
Position
chr09:join(17747301..17747621,17748112..17748462)
AA seq 223 aa AA seqDB search
MAADKGVKVFGMWASPMAIRVEWALRLKGVDYEYVDEDLANKSEALLRHNPVTKKVPVLV
HDGKPLAESTVIVEYIDEAWKHGYPIMPSDPFDRAQARFWARFAEEKCNAALYPIFMTTG
EEQRKLVHEAQQCLKTLETALEGKKFFGGDAFGYLDIVTGWFAYWLPVIEEACGVEVVTD
EALPLMKAWFDRVLAVDAVKAVLPPRDKLVALNKARREQILSA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagacaagggagtgaaggtgttcggcatgtgggcgagccccatggcgatccgt
gtggagtgggcgctccggctcaagggcgtcgactacgagtacgtcgacgaggacctcgcc
aacaagagcgaggcgctgctccggcacaacccggtgaccaagaaggtgcccgtgctggtc
cacgacggcaagcctctcgccgagtccaccgtcatcgtcgagtacatcgacgaggcctgg
aagcacggctaccccatcatgccctccgaccccttcgaccgtgctcaggcgaggttctgg
gccaggttcgctgaagagaagtgcaacgctgctctgtacccgatcttcatgacgaccgga
gaggagcagagaaagctggtgcacgaggcccagcagtgcctgaagacgctggagacggcc
ctggaggggaagaagttcttcggcggcgacgccttcggctaccttgacatcgtcaccggg
tggttcgcctactggctgccggtcatcgaggaggcctgcggcgtcgaagtcgtcaccgac
gaggcgctgcccctgatgaaggcctggttcgaccgggtcctcgccgtcgacgccgtgaag
gcggtcctgccgccgagggacaagctcgtcgcgctcaacaaggctcgccgtgagcagatc
ctctcggcgtag

DBGET integrated database retrieval system