KEGG   Dolichospermum sp. UHCC 0315A: BMF77_02928
Entry
BMF77_02928       CDS       T06185                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dou  Dolichospermum sp. UHCC 0315A
Pathway
dou00010  Glycolysis / Gluconeogenesis
dou00020  Citrate cycle (TCA cycle)
dou00620  Pyruvate metabolism
dou01100  Metabolic pathways
dou01110  Biosynthesis of secondary metabolites
dou01120  Microbial metabolism in diverse environments
dou01200  Carbon metabolism
Module
dou_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dou00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMF77_02928 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BMF77_02928 (pdhC)
   00620 Pyruvate metabolism
    BMF77_02928 (pdhC)
Enzymes [BR:dou01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMF77_02928 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: QEI42321
UniProt: A0A5C0DSF9
LinkDB
Position
3087638..3088933
AA seq 431 aa
MSINEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVPAGETAPVGAAIAYIAETEAEIATAQSLANADGAAAPSTPAPIPVPVAAIAAPATPSQ
NGSNHEPGRVVVSPRARKLAKELKVDLNTLTGSGPYGRIVAEDIEVAVGKVQPVTTPVVT
PAPTPVAAPAPVAAPAPVATPVVSSAVPGQVVPFTTLQNAVVRGMVASLSVPVFRVSYTI
STDGLDKLYKQIKSKGVTMTALLAKAVAITLQKHPILNASYSDQGIVNHPNINVSVAVAM
DDGGLITPVLQNADAVDIYSLSRNWKSLVERARAKQLQPVEYNSGTFTLSNLGMFGVDTF
DAILPPGQGSILAIGASRPQVVATPDGLFGVRQQMQVTITCDHRIIYGADAAGFLQDLAK
LIETNPQSLTM
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagcattaacgaagtatttatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtcaagtcgcctggagataaagtggagaaaggcgaaacagtggtggttgtc
gaatcagataaagctgatatggacgtggaaaccttctatgaaggatatcttgcccatatc
attgttcccgccggtgaaactgccccagtcggcgcagcgatcgcttacatagccgaaaca
gaagcagaaatagccacagcccagtccttagccaacgcagacggtgctgctgccccctcc
acacctgcccccatacccgtacccgttgccgcaattgccgcccctgccaccccatctcaa
aatggttctaaccatgaacccggcagagtcgtagtttcaccccgcgctcgcaaactagcc
aaagaactcaaagttgatttaaataccctcacaggtagtggtccctacggtcgtattgtg
gcggaagatatagaagtggcagtcggtaaagttcaacccgttactacccccgttgtcact
cccgcacctacacctgtagccgcacccgcacccgtagctgcacctgcacctgttgccaca
ccagtagttagtagtgccgttcctggtcaagtagtaccattcacaaccttacaaaatgcc
gtagttcggggcatggtagccagtttatctgtacctgtgttccgtgtcagttacacaatt
agcaccgatggactcgataaactttacaaacaaattaagtctaaaggtgtgacaatgacc
gcgctattagccaaagctgtagccataacattacaaaaacaccccatccttaatgccagc
tactcagatcaaggaattgtcaatcaccctaatattaacgtttctgtcgccgtagccatg
gatgatggtggtttaatcacacccgttttacaaaatgcagatgcagttgatatctactct
ttatctcgcaattggaaatctttagtagaacgcgctagagctaaacaactacaaccagta
gaatataacagcggtacttttacactttccaacttaggaatgtttggtgtagataccttt
gatgccattttaccccccggacaaggttctattttagccattggtgcatcacgtccccaa
gtagttgccacacctgatggattatttggtgtgcgtcaacaaatgcaagtgactattacc
tgtgatcatcgcattatttacggcgctgatgctgccggattcttgcaagacttagcgaag
ttgattgaaaccaatccccaatctttgacaatgtaa

DBGET integrated database retrieval system