KEGG   Dolichospermum sp. UHCC 0315A: BMF77_03364Help
Entry
BMF77_03364       CDS       T06185                                 

Definition
(GenBank) hypothetical protein
Organism
dou  Dolichospermum sp. UHCC 0315A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RVT_connect
Motif
Other DBs
NCBI-ProteinID: QEI42752
UniProt: A0A5C0DWL1
LinkDB All DBs
Position
3564567..3566384
Genome map
AA seq 605 aa AA seqDB search
MLLNFIDRVGELNPQLFRELKGRLKPFNLIIAMGSSLLLQLIVFLLQLREFPDEKYYLRA
TYCTLKEVYQNQEQELYKQQSLLTQKLDNYRQIQLSDNTIIPNLEAQLQQVRTELSSLQN
YLSKNICPLDKIDWQLWWRDHWEYTFLTLSVIFIFTLLVGGTYVLISDLAREEQRGTLNF
IRLSPQTETSILTGKILGVPSLIYLFVLTAIPLHFWAGHSAQIALSYIFSYYAVIAASCL
FFYSAALIFGLVSRWFSSFQPWLGSGAVLVFLLMTMTIMVSSYGNFNNPLTWMRFFSPWD
ITNYLFPNLFHSYRDSSIKELQFFYLPIGKNLITLVGFHLVNYGICSYGIWQAMKRCFRN
ADSTILSKGQSYLFVAFTQVMFFGLTMPAIDNKDNGQIICLIALLNFALVLALTIMLSPH
RQIIQNWARYRHQNHRDKSVLQDLVFGEKSPVIVAIVVNLFIATTPIMIWLLLSPTHLYD
GGVERSKVILTLVLSFSLMLMYATIAQLMLLMKNPKRYVWTVGTIGVAMFLPSIILSVLG
ISPSENPTLWLFSTFPWAAIEYTQTTTIFLALLAELTVVALLNFQLNRQVRVLGESATKT
LLSGR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgttactaaatttcatagatagagtgggagaattaaatccccaactatttcgagaacta
aaaggtagattaaaaccttttaatctgattatagctatgggttcttctttactactccaa
ctcatagtttttctcttgcaattacgagaatttcccgatgagaaatactatctcagagca
acttactgtactttgaaagaagtataccaaaaccaagaacaggaactttataaacaacag
agtttacttacccaaaaattagataattatcggcaaattcaactatcagataataccata
atccccaacttagaagcccaacttcagcaagttagaactgaactatctagcttacagaat
tatttatctaaaaatatttgtcccttagataaaatagattggcaattatggtggagagat
cattgggaatatacatttttaaccctgagtgtaatttttattttcactctattagttggg
ggaacttatgtactcatcagtgatttagccagagaagaacaacggggaacattgaatttt
attcgccttagtccccaaaccgaaacaagcattttaactggaaaaattctcggagttcct
agtttaatttatctctttgtcctcacagcaattcctttacatttctgggctgggcattcc
gctcaaattgccttgagttacattttcagttattatgctgtaattgcagctagttgtctt
ttcttctacagtgcagccctaatttttggtttagttagtcgttggtttagcagctttcaa
ccttggttgggtagcggtgctgtacttgtgttcttgttgatgaccatgacaataatggta
tcgtcttatggaaactttaataatcccctgacttggatgagattcttcagtccctgggat
attaccaattatctatttccgaatctgtttcattcctatagagattcatcaataaaggaa
ttacaatttttctatttaccaataggaaaaaatttaattaccttagttggttttcattta
gttaattacggaatttgctcctacggtatttggcaagcgatgaaacgctgctttcggaat
gcagatagtacaatattgagtaaaggacaaagttatttatttgtagcttttactcaggtg
atgtttttcggattgactatgcctgcaattgataacaaagataatggacaaataatatgc
ctaatagctttgctcaattttgccttagttctggctttaactattatgctctcaccccat
cgtcaaattatccaaaactgggcaagatatagacaccaaaatcatcgagataaatctgta
ttacaagatttagtatttggtgaaaaaagcccggtaattgtcgccatagtagttaattta
ttcattgctactaccccaataatgatttggcttttgctctcacccacacatttatatgat
ggtggtgttgaaagaagtaaagtcatattaactctggttttatccttctctttgatgctg
atgtatgccacaattgctcaactgatgctactcatgaaaaatcctaagcgttatgtatgg
acagttggtacaattggtgtagccatgtttttaccatcaattattctctcagtcttgggt
attagtccatcagaaaatccgactttgtggttattctccacctttccttgggcggcgata
gaatacactcagacgacaacaatttttctggcacttttagctgagttaactgttgtcgct
ttgttaaacttccaattaaatcgccaagtgagagttttaggcgaatctgcaaccaaaaca
ttattatcaggaagataa

DBGET integrated database retrieval system