KEGG   Dendroctonus ponderosae (mountain pine beetle): 109533541
Entry
109533541         CDS       T04899                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109533541
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109533541
NCBI-ProteinID: XP_019754436
LinkDB
Position
Unknown
AA seq 134 aa
MQLTAVVCRQSVLQEIHVIDCVGRTNNSGIMSESIPQRSKNKVCRRLIFDDDDAPEKQRN
EDLDHLDQLVDLEKLNATEKSEQMSRWNFDFDNERPLDGDWQWERVSPPSPIQQQELIKT
LEMEKEDKHNDRTV
NT seq 405 nt   +upstreamnt  +downstreamnt
atgcaacttactgcagtagtttgtcggcagtcggtgttgcaggaaattcatgtgatagat
tgtgtcggcaggacaaacaatagtggaattatgtccgaatccattccacaacgctccaag
aacaaagtgtgtagacgtttgattttcgatgacgatgacgctcctgagaagcagcgtaat
gaagacctcgaccatctggatcagctagtggatttggaaaaattgaacgccacagagaaa
agtgaacaaatgtcgcggtggaatttcgattttgataacgaaagacccttggatggcgac
tggcagtgggaacgagtgtcaccacctagtccaatccaacagcaggagctgattaagact
ctggaaatggaaaaagaggacaagcacaatgacagaactgtctag

DBGET integrated database retrieval system