KEGG   Dendroctonus ponderosae (mountain pine beetle): 109533581
Entry
109533581         CDS       T04899                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen-like isoform X1
  KO
K16679  wengen
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa04013  MAPK signaling pathway - fly
dpa04214  Apoptosis - fly
dpa04215  Apoptosis - multiple species
dpa04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109533581
   04391 Hippo signaling pathway - fly
    109533581
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109533581
   04215 Apoptosis - multiple species
    109533581
SSDB
Motif
Pfam: TNFR_c6 T_cell_tran_alt
Other DBs
NCBI-GeneID: 109533581
NCBI-ProteinID: XP_019754487
LinkDB
Position
Unknown
AA seq 289 aa
MKYILWLKHQPLNGLELEQQLFGKGTQFVRENHVMVKTNSPTLFLLLLTTSTVLASICPK
HQYLNAQQQRCMNCTECSQGTIVLLPCELHRDTHCGPISDLSELLVENSGNPHRHHHDRH
RHEKHRNKEGELVWRYGENVRGDAPSPAALEVASSEAPFSSAETLVWDWQAIALTSAVFA
CILFFLVITLYSLHQARQWRRLKENFEADVEELSARLSLMAATSTEKCEFLESEGTGFVM
GSSSATDQNYLDTRCVYLEQLLSVRKEDEKNSSSKPKGNVYIEENKAQN
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaaatatatcctttggcttaaacatcaaccattgaatggcttagagttggaacagcag
ttgtttggaaagggaactcaattcgtccgggaaaatcatgtgatggtaaaaaccaactcg
cccacactttttcttctgctattgaccacaagcacagtacttgcctcaatttgcccgaaa
caccagtacctgaacgctcaacagcaacgttgcatgaattgtacagagtgttcgcaagga
accatcgttttactgccttgcgaactgcacagagacactcattgtgggccgattagtgat
ttaagtgaactgttggtggaaaacagtggaaaccctcatcgacaccatcatgacaggcat
cgacacgaaaagcaccgaaataaagagggagagctcgtttggagatatggggaaaatgta
cgtggagacgcaccctcaccggcggcactggaagtcgccagttcagaggcgccgttctcc
agcgccgagacgctcgtctgggattggcaggcgattgccctgacttcggctgtattcgcc
tgcatcctgttttttcttgtgatcaccctgtactcgttgcaccaggccagacagtggcgg
cgcttgaaagagaatttcgaagctgatgtggaggaactttcagctcgtctctccttaatg
gcggctacatcgacggagaaatgcgaatttctcgaaagcgagggtacagggtttgtgatg
ggtagttcatctgcaaccgaccagaattatctcgacaccagatgtgtttacttggaacaa
ctgctcagcgtgagaaaagaggacgagaaaaatagcagctctaagccgaaaggaaatgtc
tacatcgaagaaaataaagcccaaaactag

DBGET integrated database retrieval system