KEGG   Dendroctonus ponderosae (mountain pine beetle): 109534689Help
Entry
109534689         CDS       T04899                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 10-like
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109534689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpa01001]
    109534689
Enzymes [BR:dpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     109534689
Protein kinases [BR:dpa01001]
 Serine/threonine kinases: TKL group
  MLK family
   109534689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH3_1 SH3_9 SH3_2 Pkinase_fungal DUF3552 DUF3104
Motif
Other DBs
NCBI-GeneID: 109534689
NCBI-ProteinID: XP_019755996
LinkDB All DBs
Position
Unknown
AA seq 1029 aa AA seqDB search
MPPLLGAPSPVRQLRRMDSTTGTRYALTSPPSCPSTPGSTQIGSPSGLCTALFDYKAQGE
DELSLRKGEIVVILSKDAKISGDEGWWTGKIGDKVGIFPANFVIDAAEEEINHVDSIFAD
VNLVKIDFKELKLDEVIGVGGFCKVYRGEWQGTEVAVKAARQDADENLQVTLENVIKEAK
LFCLLRHENIVSLKGVCLQEPNLCLILEYCRGGSLNRVLAGRKIRPDVLVDWAIQIARGM
DYLHSRAPISLIHRDLKSSNVLLSEAIENDDLNCKTLKITDFGLAREVYQTTRMSQAGTY
AWMAPEVIRESTFSKGSDIWSYGVLLWELLTGQVPYKGIDTLAVAYGVASNRLTLLIPTT
CPQPWKELMEKCWEADPHNRPSFEQILEDLNEIAHSSFTQTPHESFHIMQEDWRQEIEEV
LLDLRRKEKELRSREEKINRAQMEQRRHEEHLKQKELELHEREMYILARELDYMIQHQQP
TPTPKKRKGKFKRSRLKLKKESGSIISSPSDFRHKLTVKHTLDPKGGLGGLISPNSPPGT
PIGRLRAIALPADGVKGKTWGPSTCHQKERGQILLPEAKSSAIWSKSAPNLDKTRQSLIG
RNQSCDTDYVPPEDWGPEYPIAGAVRHNIPMPTLYNAEGQRLKPKLSIVELVLYNIAAML
AGVASGYDVRLSNISPLHPRLQPNGRIEVSDLPAWRPVEPKDYEYSTVSGYNHNTYHGPT
KHCRPMLTGSQLLTLKNEEKRPLRFTDSPQHHPPNPSPRRKSSSTSNDGSDLYGPFERAA
TIYIPGEYHRCPPEIGCAARPPESYPGYNSQQEQSHGYSSEHSGTTATLYGYGTDYAYDN
PSSVSSQSGARTPQRLTLHTHRRTPSNVSNASSTTTSGSNVNPSFRLEEEYTPTHYLARR
PQYEFEYNSYSRTNSQDSTFERPNTLETVGYTKLRSSLKRNNYASSGGGHSGGNTPTNPT
PPDSLTSDDSSYISAKESNNGSVSRVRFSPTTLIDLPVPGQSLDPTVPLQARRSRPRPTL
AEMEREFLS
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgcctccactgctgggcgccccctcgcccgtccgccagttgaggcgcatggactccact
accggcacccgctacgcgttaacaagcccccccagttgccccagcacccctggttcaacc
cagataggttctccctcgggactatgtaccgctctattcgactacaaggcgcagggggaa
gatgagctgtctcttcgcaaaggcgaaatcgtggtgattctctctaaggatgcgaaaata
tccggcgatgaaggctggtggactgggaagattggagacaaagtgggaatcttcccggcg
aactttgtcatagatgcagccgaagaggaaatcaaccatgtggactcgatctttgccgat
gttaatctggttaaaatcgattttaaggaactcaagctggatgaggtgataggagtgggc
ggcttttgcaaggtctatcgaggggaatggcaagggacagaagtggcggtgaaagcggcg
cgccaggacgccgacgaaaacctgcaagtcaccctggaaaatgtgataaaagaagcgaaa
ctcttctgtcttttgcggcacgaaaacatcgtctcgttaaagggcgtttgcctgcaggag
cccaatctctgcctgattctggagtactgtcgtggcggttccctcaaccgggtactagcc
ggtcggaagatccgaccagatgtgctggtggattgggcgattcagatcgctcgaggcatg
gactatctgcactcgagagccccaatttccctcatacaccgcgacttgaagagttcgaat
gttttacttagcgaagcgatcgaaaacgacgatttaaactgcaagactttgaaaattacc
gattttggcctggccagagaagtctatcagacgacccggatgtcacaagcaggaacgtac
gcctggatggcaccggaagtaatccgagagtcgactttttctaagggaagcgacatctgg
agttatggggtgctgctatgggaattgctaaccgggcaagtcccctataaaggcatcgac
acccttgcagttgcttatggggtggcttccaatcggctgactttgctcattcccaccaca
tgcccgcaaccctggaaggaactgatggaaaaatgttgggaggcagatccgcacaatcgg
ccctcattcgagcagattttggaggatctgaacgagatcgcacactcgtccttcactcaa
accccgcacgagtccttccacatcatgcaggaagactggcgccaggagattgaggaagtg
ctgctcgatctgcgcaggaaagaaaaggagttgcggagcagagaagagaagatcaacagg
gcccagatggagcaacgccgacacgaagagcacttgaagcagaaggagctagaactacac
gaaagggaaatgtacattttggccagggagttggactatatgattcagcatcagcaacct
acgcctactcccaagaagcgaaagggcaaattcaaacgctcccggcttaaattgaagaag
gaatcgggctcgataatcagctctccttcggattttcgacacaaattgacggtgaagcac
acacttgaccccaaggggggccttggaggcttaatcagcccgaacagtccgcctggtact
cccataggccgcttgagagccattgcgctcccagcggacggggtaaaaggtaagacgtgg
ggcccaagcacgtgccatcagaaggagaggggccaaatcctgctgccggaggcgaaaagc
agcgccatttggtcgaagagcgcccccaacttggacaagaccagacagtcgttgattggg
cggaatcagtcctgcgatacagattacgtgcctccagaggattggggccccgagtacccc
attgcgggcgctgtaagacacaacatcccgatgcccacactgtacaacgccgaaggacaa
cggctcaagccaaagctgagtatcgtggaactcgtgctttataacatcgctgccatgctg
gctggagtggcctcaggatacgatgtcagactgtcgaatatttcgcctcttcatccccgc
ctgcagcccaatgggcgaatcgaagtgtcggacctgccggcctggcggccagtagagccg
aaagactacgaatattccaccgtatccggatacaaccacaacacctatcacggtccgacc
aaacactgcagaccaatgttgacggggtcgcaactgctcaccttgaagaacgaagaaaag
cgccccttgaggttcacggattcgcctcaacatcatccccccaatccgtcgccgagacgc
aaatccagctcgacgagcaacgacggttcggatctgtacgggccctttgaacgggccgcc
accatctacattcctggagaataccatcgatgcccacccgaaatcgggtgcgcagccaga
ccgccggaatcctacccggggtataacagccagcaggagcagagccacgggtacagttcg
gagcacagtggaaccactgccaccctttatggatatggcaccgactatgcgtatgataat
ccgagtagcgtgagcagccaaagtggggcgcgcaccccccaaaggcttacgctccacacg
catcgcagaacgccctccaacgtctccaatgcaagttccaccaccacgagtggttcgaat
gtgaatcccagctttaggttggaggaagagtacactcccactcactacctggcaaggcgg
ccgcagtacgagttcgagtacaattcgtactcgcgcacgaactcgcaagactccaccttt
gaacgccccaatacgctagaaaccgtgggttacaccaagctgcgttccagcttgaaaagg
aacaactacgcatcttcagggggcgggcactcgggcggcaacacgcccaccaatcccacg
ccccccgacagtcttaccagtgacgacagttcgtacatttcagcaaaagaaagcaacaac
ggctcggtcagcagggtccggttttcccctaccaccctcatagatctgccggtgccgggg
caaagtttggaccccactgtgcccctacaagcgaggcgcagccgtccgaggcccacgctg
gccgaaatggaacgggaatttttgtcataa

DBGET integrated database retrieval system