KEGG   Dendroctonus ponderosae (mountain pine beetle): 109535486Help
Entry
109535486         CDS       T04899                                 

Definition
(RefSeq) uncharacterized protein LOC109535486
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 109535486
NCBI-ProteinID: XP_019756963
LinkDB All DBs
Position
Unknown
AA seq 208 aa AA seqDB search
MTTITLPALPYGYEDLAPHISKETLEYHHDKHHNTYVVNLNNLIAGTELEGKTLEEIITA
TAGDASKAGVFNNAAQVWNHTFYWNCMAKNGGGKATGTLAAKIDEAFGSYEKFAEEFAAA
ATTQFGSGWAWLVADEVNGQLSIMKTSNADTPMAHGKIAVLTIDVWEHAYYIDFRNARPK
YISTFLESLVNWDYANAKYAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttaccagcattaccttacggctacgaagatcttgctccacacatc
agcaaggaaactttagaataccatcacgacaaacaccacaatacgtatgtggttaacctg
aataacctgatcgctggtactgagcttgaaggcaaaactctagaagaaattattacagca
actgctggtgatgcttctaaagcaggtgttttcaataacgcggctcaagtttggaaccac
acgttctactggaactgtatggctaaaaacggtggcggtaaagcaactggtactttggct
gcaaaaattgacgaagctttcggttcttatgaaaaatttgctgaagaatttgctgctgct
gcaactactcagtttggttcaggttgggcttggttagtggctgacgaagtaaacggtcag
ctttctatcatgaaaacttcaaatgctgatacgccaatggcgcacggtaaaattgcagtg
ttgacgattgacgtttgggaacacgcttactacatcgatttccgtaatgctcgtcctaag
tacatctctactttcctagaaagcctagtaaactgggattatgcaaatgcgaaatatgca
ggtcagcctgcaggtgttgagaaataa

DBGET integrated database retrieval system