KEGG   Dendroctonus ponderosae (mountain pine beetle): 109535556
Entry
109535556         CDS       T04899                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00230  Purine metabolism
dpa01100  Metabolic pathways
dpa04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109535556
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109535556
Enzymes [BR:dpa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109535556
SSDB
Motif
Pfam: AC_N Guanylate_cyc Mt_ATP_synt RINT1_TIP1 DUF5858
Other DBs
NCBI-GeneID: 109535556
NCBI-ProteinID: XP_019757031
LinkDB
Position
Unknown
AA seq 321 aa
MGEETGIPNTKKISTLFDKILKGPGCQSESFPDSLEWLYRKFSRKQKKVGLDCFMLTAII
FSIYMLVVSNTCNSIVSIGYLIVYVGALVLSKLAIFKTDTANVRIALVCSLFVICQLGTA
AFLRGTQSTVRENLGWALIFNFMIFVTMPLPLKHCSLISWAFCSFYLLTLIACQITYRDL
HQFPQLGATGILLVVAKVLATVAYTAEDEQQRRTFLETRQSLEVKLVIEEQSAEQERLLL
SVLPEHVAVQMRKDLDQADSQFKKIYMSRHENVSILYADIVGFTAISSTYSAQELVKMLN
ELFARFDKLAEVRCSQLSKLY
NT seq 966 nt   +upstreamnt  +downstreamnt
atgggggaggaaacgggcattccaaatacgaagaaaatcagtacgctgtttgataaaatt
ctgaaagggccgggctgccaaagcgaaagttttcccgactcattggaatggctttatcgg
aagttcagccgaaaacagaaaaaggtcggattggactgtttcatgctcacagcgatcatt
ttctccatatacatgttagtggtttcgaacacctgcaactccatcgtcagcatcggttac
ttgatcgtttacgtgggtgccctggttttgagcaagttggccatcttcaagactgatacc
gccaacgttcggatagcccttgtttgctcgctcttcgtcatttgccaattgggcactgct
gcgttcctgcgaggaacccaatcgactgtgcgtgagaacctgggctgggctctcattttc
aacttcatgatcttcgttacgatgccgctcccattgaagcactgctctcttatcagctgg
gcgttttgttctttctatctactgacgctgatcgcctgccagattacatatcgggacctc
catcaattcccccagttgggagccaccggaattttgctggtagtagccaaagttcttgcc
accgttgcttatacagccgaagacgaacagcagagaagaaccttcttggagacaagacag
tctttggaggtcaagctggtgattgaagagcaaagcgctgagcaggaaaggctgctgctc
tcggtgttgccagagcatgtggctgtgcagatgaggaaggatttggatcaagccgatagc
cagtttaagaaaatctacatgagccgccacgaaaacgttagcatcctctatgcggacatt
gtcggattcaccgccatttcttccacgtattccgctcaagaattggtgaaaatgctcaat
gaactgttcgctagattcgataagcttgcagaggtaagatgtagtcaattgtccaaactt
tattaa

DBGET integrated database retrieval system