KEGG   Dendroctonus ponderosae (mountain pine beetle): 109535909Help
Entry
109535909         CDS       T04899                                 

Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00250  Alanine, aspartate and glutamate metabolism
dpa00410  beta-Alanine metabolism
dpa00430  Taurine and hypotaurine metabolism
dpa00650  Butanoate metabolism
dpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109535909
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109535909
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109535909
   00430 Taurine and hypotaurine metabolism
    109535909
Enzymes [BR:dpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109535909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase Aminotran_1_2 SepSecS
Motif
Other DBs
NCBI-GeneID: 109535909
NCBI-ProteinID: XP_019757509
UniProt: N6TKV9
LinkDB All DBs
Position
Unknown
AA seq 549 aa AA seqDB search
MPANGQGEINVDESESYSDTLASSEDEEAACLSRTIERSFTTTTLPADKLATIESLPSKR
DHEAFFRECIDIMLREAIFEGTSRRTKVLDFKQPETLLKLLDFDLKAQPSSHSDLIKSLK
DVIKYSVKTGHPYFVNQLFSSVDPYGFVGQMLTDALNPSAYTYEVAPVVILMEETVLREM
RQIVGWPNGEGDGIFCPGGSMANGYAISCARHYYFPEVKTKGLHGLPKLVLFTSEDAHYS
IKKLASFLGLGTENVHLVNTNSQGKMDPDHLEQLINTSLENGERPFMVSSTAGTTVIGAF
DPIEKLADICKKNNMWLHVDAAWGGGALISKKHRNLLKGIERADSVTWNPHKLLTAPQQC
STLLVKHKNVLSEAHSANAAYLFQKDKFYDTQYDTGDKHIQCGRKADVLKFWFMWKAKGT
SGLEQHIDKVFENAQYFYENIKQRPEFQIVIPEPECTNICFWYVPESLRMNSTEEFLDKL
QNDGEYKEKLHRVAPKIKEKMMTEGTMMVTYQTYKEKPNFFRMVFQSSGLDKNDMLHLIQ
EFERLGQGL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgaatggtcaaggggagataaatgtggacgagtcggagtcctacagtgacacc
ttggcgtcttctgaagacgaagaagccgcatgtttatcccgaaccatcgaaagatccttc
accaccactactctaccggccgacaaattagccaccatagagagcctgccatcgaaaaga
gatcacgaagcatttttcagagaatgcatagacattatgcttcgagaggccatcttcgaa
ggaacatccagaagaaccaaagttctcgatttcaagcagccagaaacgctcttaaaactc
ttggacttcgacctaaaagcccagcccagctctcacagtgacttgataaaaagcctcaag
gatgtcatcaaatattcagtgaaaaccggacatccgtatttcgtcaatcagctcttttcc
agtgtggacccatatgggtttgtggggcaaatgctgacggatgccctaaatcccagtgcg
tatacttacgaagtggcgcccgtggtaattctcatggaagaaacggtgttgagggaaatg
aggcaaattgtgggctggccaaatggagaaggcgatgggattttttgccctggaggatcc
atggctaatggctatgccattagctgtgcccgacactattatttccctgaagttaagaca
aaagggttgcacggattgcccaaacttgtgctatttacctcagaggatgctcattattcc
ataaaaaaattggcgtctttcttgggtttgggaactgaaaacgtccatctggtcaatacg
aattctcagggaaaaatggatccggatcacttggagcagcttatcaacacaagtctggaa
aacggagaaaggccttttatggtgagctccactgcaggtaccacagtgataggggcattc
gatccaatagaaaaactggcagatatttgcaaaaaaaacaacatgtggttgcatgttgat
gctgcctggggaggaggcgctctcatctcgaaaaaacaccgaaacttactaaagggaatc
gaaagagccgactcagttacatggaatccacataaactgctcaccgcccctcaacaatgc
tctacattgttggtcaagcataaaaacgtgctttcagaggctcattctgcaaatgcagct
tatctcttccaaaaggataagttttatgacactcaatacgatactggagacaaacacatt
caatgtggccgtaaagccgacgtgttgaagttttggttcatgtggaaagcaaagggaacc
agcggattggagcaacacatcgacaaagtctttgaaaacgctcagtatttctacgaaaac
atcaaacagaggcctgaattccaaatcgtgatccctgaacctgaatgtaccaacatctgc
ttctggtatgtgccggaaagtctgcggatgaacagcaccgaagaattcctcgataaattg
caaaatgatggagagtataaagaaaaattgcacagagtggcaccaaaaatcaaagaaaaa
atgatgacagaaggcacgatgatggtgacctaccaaacctacaaggagaagccgaacttc
ttcaggatggtgttccagagctccggcctggataagaatgatatgttgcatttgattcaa
gagtttgagaggctgggccagggtctttga

DBGET integrated database retrieval system