KEGG   Dendroctonus ponderosae (mountain pine beetle): 109536492Help
Entry
109536492         CDS       T04899                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00020  Citrate cycle (TCA cycle)
dpa00190  Oxidative phosphorylation
dpa01100  Metabolic pathways
dpa01200  Carbon metabolism
Module
dpa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109536492
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109536492
Enzymes [BR:dpa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109536492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 109536492
NCBI-ProteinID: XP_019758290
LinkDB All DBs
Position
Unknown
AA seq 652 aa AA seqDB search
MMKLRKHFHKSLAILQTPLRKRYSTQRLSAKCIKGSGDISQKYPIVNHQYDCIVVGAGGA
GLRASFGLVMNGFKTACITKLFPTRSHTVAAQGGINAALSNLEDDYWVWHHYDTVKGSDW
IGDQNAIHYMTKEAPTCIQELENWGMPFSRTKDGRIYQRAFGGQTLQFGDGGQAHRTCAA
ADATGHYMLHTLYGQACRHNVEFFIEYFVLDLLMADDECRGVLAWSLEDGCIHKFWAKNT
VIATGGFERAYFSCTAAHTSTGDGTAMITRTGLPLQDLEFIQFHPTGVYGVGVLITEGAR
GEGGFLTNGQGERFMERHAPKAKDLASRDVVARAMTVEIMEGRGCGPNKDYINLQLHHLP
KETIERQLPGIRQSAFTFAAVDILREPIPVIPTVHYTMGGIPTNYKGQVMTQVAPGKDQL
VRGLYACGECSSVGVHGANRLGANSLLETVVFGKAVAESITATDCPGAAVRTDDSIGGEA
LQNFDRMRYSKGKHTVGQLRLQLQKHMQKYAAVFRTEATLSEGVCRVAELYKEIDNVQMH
DHGMIWNTNLVEYCELKNLFINALQAIMAMEARTESRGAHARDDCKIRVDEYDYSKPVRN
QRKRPFEEHWRKHTLSWMDAETGEVCLTYRAVNDCTLDERECPSIPPKIRAY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattacgcaaacacttccacaaatccctagcgattctacaaacgcccctcaga
aagcgttattcgactcagcgactgagcgccaaatgcatcaaaggaagtggagatatatcg
caaaaatatcccatagtaaatcaccaatacgattgcatagtcgtaggcgccggaggagcc
ggattgagagcctcctttggcctagttatgaacggcttcaagaccgcctgcatcaccaaa
ctcttccctaccagatcgcacactgtggcggcccaaggagggatcaacgccgccctcagc
aaccttgaggacgattactgggtgtggcaccactacgacacagtcaaaggatctgattgg
attggggaccaaaacgccatccactacatgaccaaggaggccccaacctgcatccaagag
ctggagaattggggaatgccattttcccgaacgaaagatgggcgcatctaccagcgggcg
tttgggggccaaacgctgcagtttggagatgggggccaagctcatcgcacatgtgctgca
gcggacgccactggccactacatgctgcatacgctctatggacaagcctgcaggcataac
gtggagtttttcatcgaatacttcgtgctggatctgctgatggctgatgatgaatgccgc
ggggttctggcctggagcttagaggatggctgcatccacaaattctgggcgaaaaacacc
gtgattgccaccggcgggtttgaacgcgcttacttttcctgcacagctgctcacacatcc
actggggatggaaccgccatgatcactcgcactgggcttccgcttcaagacttggagttc
atccagttccacccgacaggggtttatggggtgggcgtcttgataacagaaggcgcgaga
ggcgaaggcggattcctcaccaacggccaaggggagagattcatggagcgccatgcgcct
aaggccaaagacttggcctccagggacgtggttgccagagcgatgactgtggaaatcatg
gaaggaagaggctgcggccctaacaaggactacatcaacctccagctgcaccacctcccg
aaggaaaccatcgagaggcagctgccggggatacgacaatcagccttcaccttcgcggct
gttgatatcctacgggaacccattccggtgataccaacagtccattacacaatgggaggc
atccccaccaactacaaagggcaggtgatgactcaagtcgctccaggcaaggaccaattg
gtcagagggctctacgcgtgtggggagtgttcttctgtgggagttcatggcgcaaacaga
ttgggggcgaattcgctgctggaaactgtcgtgtttggaaaagctgtagctgaaagcatc
accgcaacagactgtccgggcgccgcagtgcgaacggacgattccatcggaggagaagct
ttgcagaacttcgatcggatgcggtacagcaaaggcaagcacacggttggccagttgagg
ctgcagctccaaaaacatatgcaaaaatacgcggctgtcttcagaacagaggccacttta
agcgaaggcgtgtgcagagtggcggagctgtacaaggaaattgataacgtgcaaatgcac
gaccatggcatgatttggaacacgaacctggtggaatattgcgagctgaagaatctgttc
atcaacgctctgcaggcgataatggccatggaggcaaggacagaatctcggggggcgcat
gcaagggacgactgcaaaatcagggttgatgagtacgattactccaagccggtgaggaac
cagaggaaaaggccctttgaggagcactggaggaagcacacgctgagctggatggacgct
gaaaccggagaagtttgcctgacttatcgcgctgtaaacgattgcaccttagatgaaagg
gaatgcccatcaattcccccgaagattagggcttattaa

DBGET integrated database retrieval system