KEGG   Dendroctonus ponderosae (mountain pine beetle): 109537538
Entry
109537538         CDS       T04899                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like
  KO
K20017  Bcl-2 family protein
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa04214  Apoptosis - fly
dpa04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109537538
   04215 Apoptosis - multiple species
    109537538
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 109537538
NCBI-ProteinID: XP_019759880
LinkDB
Position
Unknown
AA seq 272 aa
MDLHCSGVDEFNIKSMSSSRTRRKLSIPVNLPQNTTGDHQAAFRRRFSNVGDAVTRKLST
TIGWRTGVNTNPPEEVVAVGRALCTLYIRAKLKKCGLFNKKLGLTRVRSAIGSLIACSTI
VKDVFPGLSCACQELERMYPKLYSNISRHTGPPPADGSVGVLLAVGHHILRSDPTWGKVV
AIYCIAAGLAVDYVRQGQNEQLHVILEDMSELLEDRMANWVHSNGGWYGLSSHCRPQNQE
VSVTEYMTIFGLVTAILLVAYFIVRFCVTFGG
NT seq 819 nt   +upstreamnt  +downstreamnt
atggatttgcactgttctggtgtcgacgaattcaacattaaatcaatgtcctcttcaaga
acccggcgaaaactcagtattcctgttaatttgccgcaaaatacaacaggagaccatcaa
gcagccttcaggagaagatttagcaatgtaggggacgcagtaacgagaaaactgtctaca
actattggctggagaaccggagtaaataccaatccacccgaagaagtggtggcagtgggt
agagctctatgcacactatacataagagccaaactgaagaaatgtgggcttttcaacaaa
aaattgggactaaccagggtgaggagcgcgataggctctttaatcgcgtgtagcacgata
gttaaggacgtgtttcctggcttgtcctgtgcttgccaggaactggaaaggatgtatccc
aagttatattcgaacatttccagacacactggccctccaccagccgacggtagtgttggt
gtgttgctagctgtaggccatcacatacttaggtctgatcccacatggggcaaggttgtt
gctatctactgtatagctgccggattagcggtcgattatgtgcgtcagggacagaacgag
caactccacgttattctagaagatatgtccgaattgctggaagatcgaatggcaaattgg
gtccattcgaacggcggatggtatgggttgagctcccattgccgtccacaaaaccaggaa
gtatcagtaacggaatacatgacgatatttggattggttacggccatcctccttgtggca
tatttcatagttaggttttgtgttacgtttggaggctga

DBGET integrated database retrieval system