KEGG   Dendroctonus ponderosae (mountain pine beetle): 109537673Help
Entry
109537673         CDS       T04899                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00052  Galactose metabolism
dpa00500  Starch and sucrose metabolism
dpa01100  Metabolic pathways
dpa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109537673
   00500 Starch and sucrose metabolism
    109537673
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109537673
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpa04147]
    109537673
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109537673
Exosome [BR:dpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109537673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 109537673
NCBI-ProteinID: XP_019760068
LinkDB All DBs
Position
Unknown
AA seq 1017 aa AA seqDB search
MKIRNIITSFRTRKPQRFTLSNSVSLEDCSNEATSDRHPGLKDSSLNNSFDISPRKHRPS
VYKQFAPGAQKGSNSSRSSPATMSSIVLLVLAAVFLIVPLIYLVNRFDVVYEDRALKRNP
IVQPFGVMQAQSVSTKPVEPSSEPIKLLPPPKPDYGQCKLLKDGDKFDCFPENGASLEGC
EARGCCWIPAKTKPKKINNIPLDVPYCFYPPNHETYKIVNVTQTAFGLVAFLQRKYLSGY
PQDVTDIQMVVKYETENRLHVKFTDPANNRFEPFFPEVPVVDRAAQNLNFVFELDMFKPG
FKVVRKADNTTIFDSNSFLDFTFSNQFMQMSSRLPSEYIYGLGDHTSNLLLSTQWARFTL
WNHDNPPWPNENLYGSHPFYLLMENSSRSHGVFLLNSNAMDILLQPTPAVTFRTIGGILD
FYFFMGPSPRDVIAQYTELIGRPFMPPYWGLGFHLCRFGYKTLNETREVLDSNLKAGIPI
DTQWNDLDYMNNSNDFTYDHIKYEGLPEFVAALHGIGMHYIPLVDPGVSAAEKPGTYPPY
DVGINMGIFVKNSSGQPFIGKVWNAHSTVWPDFTNPDTVDYWTLMLRDFHKEVPFDGAWI
DMNEPSNFLSGSFSGCPKSELESPPYVPAVDGGVLNYKTMCMTAKHYEGLHYDVHNLYGF
TEAIITSFAMAVIRGARPMVISRSTFSGLGHYTGHWSGDVFSTWDGLKQSIPHLLSFSLF
GIPLMGADICGFNGNTTVALCNRWQQLGAFYPFSRNHNTDDGIPQDPASMGDLVVASTKK
ALEVRYALLPYLYTLFFRAHVDGDTVARPLFFEFFSDKKTFGIDTQFLWGSAVMIVPVLE
ENATTVKAYFPAALWFDYYSKAQVTSAGEYVNVSAPLDTIPVFIRGGTILPRQAPLRTTT
ESRKTSIELLVAPDENGAALGELFWDDGDSLNTIEEKRYSLIDFKLENGILRGESLAWAQ
EYPPNLGSVTVLGLQQPISQVLVNGQSFTFKFDTVHKCLLIDNLNVSFEKPLAITWK
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaacataatcacctcatttcggacgagaaagccccaacgattcactctc
tccaactctgtgagtttggaagactgttcgaatgaagcgacctcagacagacaccctggg
ctcaaggactcatctctgaataattcctttgatatttcgcctagaaagcaccgtccgtcc
gtttacaaacaattcgccccaggggcccagaagggcagtaactcgtcccgctcaagtcca
gccacgatgtcttccatagttttgctagttctggcggcagtttttctgatagttcctctt
atatatttggtgaatcggtttgatgtcgtatacgaggatcgagcattgaagcgcaacccg
atcgtgcagccttttggggtaatgcaggcgcagtcagtttcgaccaaaccagtggaaccg
tccagcgaacctatcaaactgctgccacctcccaagccagattatggacagtgcaagctg
ttgaaggatggtgataaattcgactgttttcccgagaatggggctagtttagaaggatgt
gaggccagaggctgttgttggataccggctaaaactaagcccaaaaaaattaacaacatt
ccgctggacgtgccatattgcttctacccgcccaaccatgagacttacaagatcgtaaac
gtgacacagactgcctttggtctggtggcctttttgcaaagaaagtacttgagcggctac
ccccaggatgttacggacattcaaatggtggtcaagtacgagacggagaaccggctgcat
gtcaagttcaccgacccggctaacaatcgctttgagccgtttttccccgaggtgccggtg
gtcgatcgcgcggctcaaaacttgaacttcgtttttgagctggacatgttcaagcccggc
ttcaaggtggtaaggaaggccgataacaccaccatattcgactcaaatagctttttggat
ttcactttctccaatcagttcatgcaaatgagcagccgcctaccgtctgagtatatttat
ggtcttggggaccacacttcgaacttgcttcttagcactcagtgggccagattcaccctg
tggaaccatgataatcctccctggcccaacgaaaacttgtatgggtcgcacccgttttat
cttctgatggagaattcgtccagaagtcacggggtttttctactgaatagcaatgccatg
gatattttgctgcaacccaccccagctgtaacgtttcgcaccataggcggcatcttggat
ttctacttcttcatggggccgagccctagagatgtgatcgcgcaatacaccgaactgatt
ggacggccttttatgccgccctattggggcctgggctttcatctgtgtcgcttcggctac
aagactttgaacgaaacgcgcgaggtgctggacagcaatctaaaggcgggcattcctatt
gacacccagtggaacgatctggattacatgaacaacagtaacgacttcacctacgaccat
attaagtacgaaggtttacccgagtttgtagcggcgctgcatgggatcgggatgcattat
atcccgttggtcgatccgggcgttagcgcagctgaaaagccaggcacttacccgccgtat
gatgtcgggattaacatggggatttttgtaaagaattcctcaggacagccgtttattggc
aaagtgtggaacgcgcattcaacagtgtggcccgactttaccaaccccgacactgtggac
tactggacgctgatgctgagggacttccacaaagaggtaccttttgatggcgcctggatc
gacatgaacgaaccgtccaactttctatcgggctcctttagcggctgccccaagtcggaa
ctggaaagccccccgtatgtaccagcagtggatgggggcgttctcaactacaaaactatg
tgcatgaccgctaaacactacgaagggctgcattacgatgtgcacaacttgtacgggttc
accgaagccattattaccagcttcgccatggcagtgatcagaggcgcacgtcccatggta
atttcaagatcgacgttcagtgggctggggcactataccggacattggagcggcgacgtt
ttttccacatgggacggcctgaagcagagcattccccatttattgagcttcagtctgttt
ggcataccgctgatgggcgctgatatttgcggcttcaacggcaacactactgtagcgctg
tgtaatcggtggcagcagttgggcgccttttacccattctcccgcaaccacaacactgat
gatgggataccgcaggatcccgcctcaatgggcgatttggtggtggcatccactaagaag
gccctggaagtgagatacgcccttctgccctacttgtacacgctgttcttcagggcgcac
gttgatggcgatacagtagctcgccccttgttcttcgagttcttcagcgataagaaaaca
ttcggcattgacacccaattcctatggggaagcgccgttatgatcgtgccagttttagag
gaaaacgccacgactgtaaaggcttatttccccgcagcactttggtttgattactattct
aaggctcaggtaacgagtgcgggagagtatgtaaatgtgagtgcgcctctggacactatt
ccggtgtttattcgaggaggcaccattttaccgcgccaggcgcctctccgcactaccaca
gagagcagaaagacctcgattgagctcttggttgcgcctgacgagaacggcgcagccctc
ggtgagcttttttgggacgacggagattcattgaatactatcgaagaaaaacgatattcc
ctgattgatttcaagctggaaaatggcattttgcggggcgaaagcttggcttgggcacag
gaatatccgcccaatttaggctctgtaactgtcttagggctgcagcagccaatcagccag
gtgctggtcaacggacagtcattcactttcaagttcgacactgtgcacaagtgcctgctc
attgacaatctcaacgtttccttcgagaagcccctagccattacctggaaatga

DBGET integrated database retrieval system